Products

View as table Download

PDHA2 (Myc-DDK-tagged)-Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PDHA2 (GFP-tagged) - Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDHA2 (Myc-DDK tagged) - Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDHA2 (mGFP-tagged) - Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PDHA2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 290-318 amino acids from the Central region of Human PDHA2

Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-PDHA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG

PDHA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PDHA2 MS Standard C13 and N15-labeled recombinant protein (NP_005381)

Tag C-Myc/DDK
Expression Host HEK293

PDHA2 (untagged)-Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 1,070.00

4 Weeks

Transient overexpression of PDHA2 (NM_005390) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PDHA2 (NM_005390) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PDHA2 (NM_005390) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack