SDS (Myc-DDK-tagged)-Human serine dehydratase (SDS)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SDS (Myc-DDK-tagged)-Human serine dehydratase (SDS)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SDS (GFP-tagged) - Human serine dehydratase (SDS)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human serine dehydratase (SDS), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SDS (Myc-DDK tagged) - Human serine dehydratase (SDS), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human serine dehydratase (SDS), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SDS (mGFP-tagged) - Human serine dehydratase (SDS), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-SDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDS antibody: synthetic peptide directed towards the N terminal of human SDS. Synthetic peptide located within the following region: AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA |
Rabbit Polyclonal Anti-SDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDS antibody: synthetic peptide directed towards the middle region of human SDS. Synthetic peptide located within the following region: KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI |
SDS (untagged)-Human serine dehydratase (SDS)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SDS (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human SDS. |
SDS HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of serine dehydratase (SDS)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS MS Standard C13 and N15-labeled recombinant protein (NP_006834)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI4E1 (formerly 4E1), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
SDS mouse monoclonal antibody, clone OTI4E1 (formerly 4E1), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
SDS mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
SDS mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SDS mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI1C8 (formerly 1C8), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
SDS mouse monoclonal antibody, clone OTI1C8 (formerly 1C8), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
SDS mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI4C3 (formerly 4C3), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
SDS mouse monoclonal antibody, clone OTI4C3 (formerly 4C3), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SDS mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI1H5 (formerly 1H5), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
SDS mouse monoclonal antibody, clone OTI1H5 (formerly 1H5), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SDS mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |