Products

cDNA Clones (26)
Proteins (13)
Antibodies (2)
Jump to Filters
View as table Download
ST6GALNAC6 (NM_013443) Human Tagged ORF Clone
RC200218

USD 98.00

USD 560.00

In Stock

ST6GALNAC6 (Myc-DDK-tagged)-Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_013443) Human Tagged ORF Clone Lentiviral Particle
RC200218L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, ST6GALNAC6 (Myc-DDK tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ST6GALNAC6 (NM_013443) Human Tagged ORF Clone Lentiviral Particle
RC200218L2V

USD 1,020.00

2 Weeks

Lenti ORF particles, ST6GALNAC6 (mGFP-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ST6GALNAC6 (NM_013443) Human Tagged Lenti ORF Clone
RC200218L3

USD 768.00

3 Weeks

Lenti ORF clone of Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ST6GALNAC6 (NM_013443) Human Tagged ORF Clone Lentiviral Particle
RC200218L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, ST6GALNAC6 (Myc-DDK tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ST6GALNAC6 (NM_013443) Human Tagged Lenti ORF Clone
RC200218L4

USD 768.00

3 Weeks

Lenti ORF clone of Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ST6GALNAC6 (NM_013443) Human Tagged ORF Clone Lentiviral Particle
RC200218L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, ST6GALNAC6 (mGFP-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ST6GALNAC6 (NM_001287003) Human Tagged ORF Clone
RC235532

USD 420.00

2 Weeks

ST6GALNAC6 (myc-DDK-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_001287000) Human Tagged ORF Clone
RC237295

USD 420.00

2 Weeks

ST6GALNAC6 (myc-DDK-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_001287001) Human Tagged ORF Clone
RC237296

USD 420.00

2 Weeks

ST6GALNAC6 (myc-DDK-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_001287002) Human Tagged ORF Clone
RC237297

USD 420.00

2 Weeks

ST6GALNAC6 (myc-DDK-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_001286999) Human Tagged ORF Clone
RC237819

USD 420.00

2 Weeks

ST6GALNAC6 (myc-DDK-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_013443) Human Tagged ORF Clone
RG200218

USD 460.00

3 Weeks

ST6GALNAC6 (GFP-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_013443) Human Tagged Lenti ORF Clone
RC200218L2

USD 768.00

In Stock

Lenti ORF clone of Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ST6GALNAC6 (NM_013443) Human Tagged Lenti ORF Clone
RC200218L1

USD 768.00

In Stock

Lenti ORF clone of Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ST6GALNAC6 Rabbit Polyclonal Antibody
TA341921

USD 375.00

5 Days

Rabbit Polyclonal Anti-ST6GALNAC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC6. Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP
ST6GALNAC6 Rabbit Polyclonal Antibody
TA341922

USD 375.00

5 Days

Rabbit Polyclonal Anti-ST6GALNAC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the N terminal of human ST6GALNAC6. Synthetic peptide located within the following region: ALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKT
ST6GALNAC6 (NM_001287003) Human Tagged ORF Clone
RG235532

USD 460.00

2 Weeks

ST6GALNAC6 (GFP-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_001287000) Human Tagged ORF Clone
RG237295

USD 460.00

2 Weeks

ST6GALNAC6 (GFP-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_001287001) Human Tagged ORF Clone
RG237296

USD 460.00

2 Weeks

ST6GALNAC6 (GFP-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_001287002) Human Tagged ORF Clone
RG237297

USD 460.00

2 Weeks

ST6GALNAC6 (GFP-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_001286999) Human Tagged ORF Clone
RG237819

USD 460.00

2 Weeks

ST6GALNAC6 (GFP-tagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ST6GALNAC6 (NM_013443) Human Untagged Clone
SC115215

USD 760.00

4 Weeks

ST6GALNAC6 (untagged)-Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
ST6GALNAC6 (NM_001287003) Human Untagged Clone
SC333426

USD 310.00

2 Weeks

ST6GALNAC6 (untagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ST6GALNAC6 (NM_001287000) Human Untagged Clone
SC335189

USD 310.00

2 Weeks

ST6GALNAC6 (untagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ST6GALNAC6 (NM_001287001) Human Untagged Clone
SC335190

USD 310.00

2 Weeks

ST6GALNAC6 (untagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ST6GALNAC6 (NM_001287002) Human Untagged Clone
SC335191

USD 310.00

2 Weeks

ST6GALNAC6 (untagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ST6GALNAC6 (NM_001286999) Human Untagged Clone
SC335713

USD 380.00

2 Weeks

ST6GALNAC6 (untagged) - Human ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (ST6GALNAC6), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ST6GALNAC6 (NM_013443) ICC Control Block
TB400218

USD 1,210.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_013443) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ST6GALNAC6 (NM_001287003) ICC Control Block
TB435532

USD 1,070.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001287003) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ST6GALNAC6 (NM_001287000) ICC Control Block
TB437295

USD 1,070.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001287000) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ST6GALNAC6 (NM_001287001) ICC Control Block
TB437296

USD 1,070.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001287001) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ST6GALNAC6 (NM_001287002) ICC Control Block
TB437297

USD 1,070.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001287002) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ST6GALNAC6 (NM_001286999) ICC Control Block
TB437819

USD 1,070.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001286999) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ST6GALNAC6 Cytosection
TS400218

USD 225.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_013443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ST6GALNAC6 Cytosection
TS400218P5

USD 889.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_013443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ST6GALNAC6 ICC Control Sections
TS435532P5

USD 889.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001287003) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ST6GALNAC6 ICC Control Sections
TS437295P5

USD 889.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001287000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ST6GALNAC6 ICC Control Sections
TS437296P5

USD 889.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001287001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ST6GALNAC6 ICC Control Sections
TS437297P5

USD 889.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001287002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ST6GALNAC6 ICC Control Sections
TS437819P5

USD 889.00

4 Weeks

Transient overexpression of ST6GALNAC6 (NM_001286999) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack