TPH2 (Myc-DDK-tagged)-Human tryptophan hydroxylase 2 (TPH2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
TPH2 (Myc-DDK-tagged)-Human tryptophan hydroxylase 2 (TPH2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPH2 (GFP-tagged) - Human tryptophan hydroxylase 2 (TPH2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of TPH2 (Myc-DDK-tagged)-Human tryptophan hydroxylase 2 (TPH2)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TPH2 (Myc-DDK-tagged)-Human tryptophan hydroxylase 2 (TPH2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TPH2 (mGFP-tagged)-Human tryptophan hydroxylase 2 (TPH2)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TPH2 (mGFP-tagged)-Human tryptophan hydroxylase 2 (TPH2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal TPH2 (Ab-19) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19 (G-FI-SP-L-D). |
TPH2 (untagged)-Human tryptophan hydroxylase 2 (TPH2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal TPH2(Ser19) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human: Ser19, Mouse: Ser19, Rat: Ser19 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19. |
Modifications | Phospho-specific |
Rabbit polyclonal TPH2 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TPH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-193 amino acids from the Central region of human TPH2. |
Rabbit Polyclonal Anti-TPH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the N terminal of human TPH2. Synthetic peptide located within the following region: REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS |
Goat Anti-TPH2 (aa16-29) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RGFSLDSAVPEEHQ-C, from the N Terminus of the protein sequence according to NP_775489.2. |
Rabbit Polyclonal Anti-TPH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the middle region of human TPH2. Synthetic peptide located within the following region: KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA |
Rabbit Polyclonal Tryptophan hydroxylase 2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human Tryptophan hydroxylase 2 protein (between residues 1-100) [UniProt Q8IWU9] |
Rabbit Polyclonal Tryptophan hydroxylase 2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human Tryptophan hydroxylase 2 protein (between residues 100-200) [UniProt Q8IWU9] |
Purified recombinant protein of Human tryptophan hydroxylase 2 (TPH2)
Tag | N-His |
Expression Host | E. coli |
USD 2,055.00
3 Weeks
TPH2 MS Standard C13 and N15-labeled recombinant protein (NP_775489)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-TPH2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TPH2 |
Transient overexpression of TPH2 (NM_173353) in HEK293T cells paraffin embedded controls for ICC/IHC staining
USD 1,900.00
3 Weeks
Purified recombinant protein of Human tryptophan hydroxylase 2 (TPH2)
Tag | N-His |
Expression Host | E. coli |
USD 760.00
3 Weeks
Purified recombinant protein of Human tryptophan hydroxylase 2 (TPH2)
Tag | N-His |
Expression Host | E. coli |
USD 2,800.00
3 Weeks
Purified recombinant protein of Human tryptophan hydroxylase 2 (TPH2)
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of TPH2 (NM_173353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TPH2 (NM_173353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack