Products

View as table Download

UGT1A6 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

USD 98.00

USD 390.00

In Stock

UGT1A6 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

UGT1A6 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

UGT1A6 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

UGT1A6 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A6 antibody: synthetic peptide directed towards the C terminal of human UGT1A6. Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224)

UGT1A6 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

UGT1A6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

UGT1A6 MS Standard C13 and N15-labeled recombinant protein (NP_995584)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UGT1A6

UGT1A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Transient overexpression of UGT1A6 (NM_205862) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of UGT1A6 (NM_001072) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of UGT1A6 (NM_205862) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of UGT1A6 (NM_205862) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of UGT1A6 (NM_001072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of UGT1A6 (NM_001072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack