Germany
Japan
United Kingdom
China
UGT1A6 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
UGT1A6 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
UGT1A6 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
UGT1A6 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
UGT1A6 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405752 is the updated version of KN205752.
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ugt1a6 (Myc-DDK-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A6 (Ugt1a6), transcript variant 2, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ugt1a6 (Myc-DDK-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A6 (Ugt1a6), transcript variant 2, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ugt1a6 (Myc-DDK-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A6 (Ugt1a6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ugt1a6 (mGFP-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A6 (Ugt1a6), transcript variant 2, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ugt1a6 (GFP-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A6 (Ugt1a6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ugt1a6 (myc-DDK-tagged) - Rat UDP glucuronosyltransferase 1 family, polypeptide A6 (Ugt1a6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
UGT1A6 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
UGT1A6 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-UGT1A6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT1A6 antibody: synthetic peptide directed towards the C terminal of human UGT1A6. Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224) |
UGT1A6 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
UGT1A6 CRISPRa kit - CRISPR gene activation of human UDP glucuronosyltransferase family 1 member A6
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene UGT1A6
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene UGT1A6
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene UGT1A6
UGT1A6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
UGT1A6 MS Standard C13 and N15-labeled recombinant protein (NP_995584)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ugt1a6 (untagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A6 (Ugt1a6), transcript variant 2, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ugt1a6 (untagged) - Rat UDP glucuronosyltransferase 1 family, polypeptide A6 (Ugt1a6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of UDP glucuronosyltransferase 1 family polypeptide A6 (UGT1A6) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of UDP glucuronosyltransferase 1 family polypeptide A6 (UGT1A6) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Ugt1a6 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-UGT1A6 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human UGT1A6 |
UGT1A6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
UGT1A6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 65-270 of human UGT1A6 (NP_001063.2). |
| Modifications | Unmodified |
UGT1A6 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 65-270 of human UGT1A6 (NP_001063.2). |
Transient overexpression of UGT1A6 (NM_205862) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGT1A6 (NM_001072) in HEK293T cells paraffin embedded controls for ICC/IHC staining
UGT1A6 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
UGT1A6 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- UGT1A6
Filter by
Species
Antibody Hosts
Isotypes
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Modifications
Mutants
Mammalian Cell Selection
Families
Pathways
- Androgen and estrogen metabolism (32)
- Ascorbate and aldarate metabolism (32)
- Drug metabolism - cytochrome P450 (32)
- Drug metabolism - other enzymes (32)
- Metabolic pathways (32)
- Metabolism of xenobiotics by cytochrome P450 (32)
- Pentose and glucuronate interconversions (32)
- Porphyrin and chlorophyll metabolism (32)
- Retinol metabolism (32)
- Starch and sucrose metabolism (32)