Germany
Japan
United Kingdom
China
GSTA5 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 5 (GSTA5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GSTA5 (Myc-DDK tagged) - Human glutathione S-transferase alpha 5 (GSTA5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GSTA5 (mGFP-tagged) - Human glutathione S-transferase alpha 5 (GSTA5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GSTA5 (GFP-tagged) - Human glutathione S-transferase alpha 5 (GSTA5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GSTA5 (Myc-DDK tagged) - Human glutathione S-transferase alpha 5 (GSTA5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GSTA5 (mGFP-tagged) - Human glutathione S-transferase alpha 5 (GSTA5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GSTA5 (untagged)-Human glutathione S-transferase alpha 5 (GSTA5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal Anti-GSTA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5. Synthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE |
GSTA5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of glutathione S-transferase alpha 5 (GSTA5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GSTA5 MS Standard C13 and N15-labeled recombinant protein (NP_714543)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of GSTA5 (NM_153699) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GSTA5 (NM_153699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GSTA5 (NM_153699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GSTA5
Pathways
- Metabolism of xenobiotics by cytochrome P450