GSTA5 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 5 (GSTA5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GSTA5 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 5 (GSTA5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GSTA5 (Myc-DDK tagged) - Human glutathione S-transferase alpha 5 (GSTA5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GSTA5 (mGFP-tagged) - Human glutathione S-transferase alpha 5 (GSTA5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GSTA5 (GFP-tagged) - Human glutathione S-transferase alpha 5 (GSTA5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTA5 (Myc-DDK tagged) - Human glutathione S-transferase alpha 5 (GSTA5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTA5 (mGFP-tagged) - Human glutathione S-transferase alpha 5 (GSTA5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GSTA5 (untagged)-Human glutathione S-transferase alpha 5 (GSTA5)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Anti-GSTA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5. Synthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE |
GSTA5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of glutathione S-transferase alpha 5 (GSTA5)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GSTA5 MS Standard C13 and N15-labeled recombinant protein (NP_714543)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of GSTA5 (NM_153699) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GSTA5 (NM_153699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GSTA5 (NM_153699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack