Products

cDNA Clones (18)
Proteins (16)
Antibodies (8)
Jump to Filters
View as table Download
B4GALT3 (NM_003779) Human Tagged ORF Clone
RC202909

USD 420.00

In Stock

B4GALT3 (Myc-DDK-tagged)-Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
B4GALT3 (NM_003779) Human Tagged ORF Clone Lentiviral Particle
RC202909L1V

USD 820.00

4 Weeks

Lenti ORF particles, B4GALT3 (Myc-DDK tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
B4GALT3 (NM_003779) Human Tagged ORF Clone Lentiviral Particle
RC202909L2V

USD 820.00

6 Weeks

Lenti ORF particles, B4GALT3 (mGFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
B4GALT3 (NM_001199873) Human Tagged ORF Clone
RC233967

USD 420.00

In Stock

B4GALT3 (Myc-DDK tagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (NM_001199874) Human Tagged ORF Clone
RC233968

USD 420.00

In Stock

B4GALT3 (Myc-DDK tagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (NM_003779) Human Tagged ORF Clone
RG202909

USD 460.00

In Stock

B4GALT3 (GFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (NM_003779) Human Tagged ORF Clone
RC202909L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (NM_003779) Human Tagged ORF Clone Lentiviral Particle
RC202909L3V

USD 820.00

6 Weeks

Lenti ORF particles, B4GALT3 (Myc-DDK tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (NM_003779) Human Tagged ORF Clone
RC202909L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (NM_003779) Human Tagged ORF Clone Lentiviral Particle
RC202909L4V

USD 820.00

6 Weeks

Lenti ORF particles, B4GALT3 (mGFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (NM_001199873) Human Tagged ORF Clone
RG233967

USD 460.00

3 Weeks

B4GALT3 (GFP-tagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (NM_001199874) Human Tagged ORF Clone
RG233968

USD 460.00

3 Weeks

B4GALT3 (GFP-tagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone
RC212741L1

USD 768.00

In Stock

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
B4GALT3 (NM_003779) Human Tagged ORF Clone
RC202909L1

USD 768.00

In Stock

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
B4GALT3 Rabbit Polyclonal Antibody
TA314795

USD 345.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.
B4GALT3 (NM_003779) Human Tagged ORF Clone
RC202909L2

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
B4GALT3 (NM_003779) Human Untagged Clone
SC320166

USD 760.00

In Stock

B4GALT3 (untagged)-Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
B4GALT3 (NM_003779) Human Over-expression Lysate
LC401244

USD 121.00

In Stock

B4GALT3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
B4GALT3 (NM_003779) Human Recombinant Protein
TP762127

USD 215.00

In Stock

Purified recombinant protein of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2,Gln100-end, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
B4GALT3 (NM_003779) Human Over-expression Lysate
LY401244

USD 396.00

5 Days

Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
B4GALT3 Rabbit Polyclonal Antibody
TA338207

USD 375.00

5 Days

Rabbit Polyclonal Anti-B4GALT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the N terminal of human B4GALT3. Synthetic peptide located within the following region: PQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCE
B4GALT3 Rabbit Polyclonal Antibody
TA338208

USD 375.00

5 Days

Rabbit Polyclonal Anti-B4GALT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the middle region of human B4GALT3. Synthetic peptide located within the following region: MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN
B4GALT3 (NM_003779) Human Recombinant Protein
TP721112

USD 330.00

3 Weeks

Purified recombinant protein of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2

Tag C-His
Expression Host HEK293
B4GALT3 Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF808622

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
B4GALT3 (NM_001199873) Human Untagged Clone
SC331386

USD 390.00

5 Weeks

B4GALT3 (untagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 1

Vector pCMV6 series
Tag Tag Free
B4GALT3 (NM_001199874) Human Untagged Clone
SC331387

USD 390.00

5 Weeks

B4GALT3 (untagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 3

Vector pCMV6 series
Tag Tag Free
B4GALT3 Mouse Monoclonal Antibody [Clone ID: OTI1G9]
TA808622

USD 379.00

In Stock

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
B4GALT3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA808622AM

USD 420.00

4 Weeks

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
B4GALT3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]
TA808622BM

USD 420.00

4 Weeks

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
B4GALT3 Mouse Monoclonal Antibody [Clone ID: OTI1G9]
TA808622S

USD 159.00

2 Days

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
B4GALT3 (NM_003779) ICC Control Block
TB402909

USD 1,070.00

4 Weeks

Transient overexpression of B4GALT3 (NM_003779) in HEK293T cells paraffin embedded controls for ICC/IHC staining

B4GALT3 (NM_001199873) ICC Control Block
TB433967

USD 1,070.00

4 Weeks

Transient overexpression of B4GALT3 (NM_001199873) in HEK293T cells paraffin embedded controls for ICC/IHC staining

B4GALT3 (NM_001199874) ICC Control Block
TB433968

USD 1,070.00

4 Weeks

Transient overexpression of B4GALT3 (NM_001199874) in HEK293T cells paraffin embedded controls for ICC/IHC staining

B4GALT3 (NM_003779) Human Recombinant Protein
TP721112L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2

Tag C-His
Expression Host HEK293
B4GALT3 (NM_003779) Human Recombinant Protein
TP721112M

USD 760.00

3 Weeks

Purified recombinant protein of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2

Tag C-His
Expression Host HEK293
B4GALT3 (NM_003779) Human Recombinant Protein
TP721112XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3), transcript variant 2

Tag C-His
Expression Host HEK293
B4GALT3 Cytosection
TS402909

USD 225.00

4 Weeks

Transient overexpression of B4GALT3 (NM_003779) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

B4GALT3 Cytosection
TS402909P5

USD 889.00

4 Weeks

Transient overexpression of B4GALT3 (NM_003779) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

B4GALT3 Cytosection
TS433967

USD 225.00

4 Weeks

Transient overexpression of B4GALT3 (NM_001199873) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

B4GALT3 Cytosection
TS433967P5

USD 889.00

4 Weeks

Transient overexpression of B4GALT3 (NM_001199873) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

B4GALT3 Cytosection
TS433968

USD 225.00

4 Weeks

Transient overexpression of B4GALT3 (NM_001199874) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

B4GALT3 Cytosection
TS433968P5

USD 889.00

4 Weeks

Transient overexpression of B4GALT3 (NM_001199874) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack