Germany
Japan
United Kingdom
China
IFNGR1 (Myc-DDK-tagged)-Human interferon gamma receptor 1 (IFNGR1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human interferon gamma receptor 1 (IFNGR1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, IFNGR1 (Myc-DDK tagged) - Human interferon gamma receptor 1 (IFNGR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IFNGR1 (mGFP-tagged) - Human interferon gamma receptor 1 (IFNGR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
IFNGR1 (GFP-tagged) - Human interferon gamma receptor 1 (IFNGR1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IFNGR1 (Myc-DDK tagged) - Human interferon gamma receptor 1 (IFNGR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, IFNGR1 (mGFP-tagged) - Human interferon gamma receptor 1 (IFNGR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IFNGR1 (untagged)-Human interferon gamma receptor 1 (IFNGR1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
IFNGR1 (untagged)-Human interferon gamma receptor 1 (IFNGR1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit anti-IFNGR1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNGR1 |
Transient overexpression lysate of interferon gamma receptor 1 (IFNGR1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
IFNGR1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
IFNGR1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 460-489 amino acids from the C-terminal region of human IFNGR1 |
Rabbit Polyclonal Anti-IFNGR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNGR1 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNGR1. Synthetic peptide located within the following region: EVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVS |
IFNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_000407)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of IFNGR1 (NM_000416) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IFNGR1 (NM_000416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IFNGR1 (NM_000416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IFNGR1
Pathways
- Natural killer cell mediated cytotoxicity