Products

cDNA Clones (11)
Antibodies (8)
Proteins (7)
Jump to Filters
View as table Download
APJ Receptor (APLNR) (NM_005161) Human Tagged ORF Clone
RG207576

USD 460.00

In Stock

APLNR (GFP-tagged) - Human apelin receptor (APLNR), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
APJ Receptor (APLNR) (NM_005161) Human Untagged Clone
SC125334

USD 310.00

In Stock

APLNR (untagged)-Human apelin receptor (APLNR), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
APJ Receptor (APLNR) (NM_005161) Human Tagged ORF Clone Lentiviral Particle
RC207576L3V

USD 820.00

5 Weeks

Lenti ORF particles, APLNR (Myc-DDK tagged) - Human apelin receptor (APLNR), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
APJ Receptor (APLNR) (NM_005161) Human Tagged ORF Clone
RC207576L4

USD 620.00

3 Weeks

Lenti ORF clone of Human apelin receptor (APLNR), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA349241

USD 380.00

In Stock

Rabbit Polyclonal Anti-APLNR Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human APLNR
APJ Receptor (APLNR) (NM_005161) Human Over-expression Lysate
LC401579

USD 121.00

In Stock

APLNR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA308705

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 2 and 96 of Apelin Receptor (Uniprot ID#P35414)
APJ Receptor (APLNR) (NM_005161) Human Over-expression Lysate
LY401579

USD 396.00

In Stock

Transient overexpression lysate of apelin receptor (APLNR), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA308706

USD 415.00

In Stock

Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 284 and 376 of Apelin Receptor (Uniprot ID#P35414)
APJ Receptor (APLNR) (NM_005161) Human Tagged ORF Clone
RC207576L2

USD 620.00

3 Weeks

Lenti ORF clone of Human apelin receptor (APLNR), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA312186

USD 345.00

4 Weeks

Rabbit polyclonal anti-AGTRL1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AGTRL1.
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA340520

USD 425.00

5 Days

Rabbit Polyclonal Anti-APLNR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen APLNR/ Apelin Receptor / APJ antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human Apelin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda, Horse (100%); Orangutan, Marmoset, Mouse, Rat, Bat, Rabbit (94%).
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA341362

USD 425.00

5 Days

Rabbit Polyclonal Anti-APLNR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen APLNR/ Apelin Receptor / APJ antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human Apelin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bat, Horse, Rabbit (100%); Elephant (95%); Platypus (90%).
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA342806

USD 375.00

5 Days

Rabbit Polyclonal Anti-APLNR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APLNR antibody: synthetic peptide directed towards the N terminal of human APLNR. Synthetic peptide located within the following region: NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW
APJ Receptor (APLNR) (NM_005161) Human Mass Spec Standard
PH307576

USD 2,055.00

3 Weeks

APLNR MS Standard C13 and N15-labeled recombinant protein (NP_005152)

Tag C-Myc/DDK
Expression Host HEK293
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA321681

USD 345.00

In Stock

Anti-APLNR Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 272-380 amino acids of human apelin receptor
APJ Receptor (APLNR) ICC Control Block
TB407576

USD 1,070.00

4 Weeks

Transient overexpression of APLNR (NM_005161) in HEK293T cells paraffin embedded controls for ICC/IHC staining

APJ Receptor (APLNR) Cytosection
TS407576

USD 225.00

4 Weeks

Transient overexpression of APLNR (NM_005161) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

APJ Receptor (APLNR) Cytosection
TS407576P5

USD 889.00

4 Weeks

Transient overexpression of APLNR (NM_005161) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack