Products

cDNA Clones (7)
Antibodies (6)
Proteins (5)
Jump to Filters
View as table Download
GABA A Receptor alpha 3 (GABRA3) (NM_000808) Human Tagged ORF Clone
RG206286

USD 460.00

In Stock

GABRA3 (GFP-tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 3 (GABRA3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GABA A Receptor alpha 3 (GABRA3) (NM_000808) Human Tagged ORF Clone Lentiviral Particle
RC206286L3V

USD 820.00

6 Weeks

Lenti ORF particles, GABRA3 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, alpha 3 (GABRA3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 3 (GABRA3) (NM_000808) Human Tagged ORF Clone Lentiviral Particle
RC206286L4V

USD 820.00

6 Weeks

Lenti ORF particles, GABRA3 (mGFP-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, alpha 3 (GABRA3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 3 (GABRA3) (NM_000808) Human Untagged Clone
SC119670

USD 540.00

In Stock

GABRA3 (untagged)-Human gamma-aminobutyric acid (GABA) A receptor, alpha 3 (GABRA3)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GABA A Receptor alpha 3 (GABRA3) Rabbit Polyclonal Antibody
TA328699

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus.
GABA A Receptor alpha 3 (GABRA3) (NM_000808) Human Over-expression Lysate
LC424511

USD 121.00

In Stock

GABRA3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GABA A Receptor alpha 3 (GABRA3) (NM_000808) Human Over-expression Lysate
LY424511

USD 396.00

In Stock

Transient overexpression lysate of gamma-aminobutyric acid (GABA) A receptor, alpha 3 (GABRA3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GABA A Receptor alpha 3 (GABRA3) Rabbit Polyclonal Antibody
TA338502

USD 310.00

5 Days

Rabbit Polyclonal Anti-GABRA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the middle region of human GABRA3. Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
GABA A Receptor alpha 3 (GABRA3) (480-492) Goat Polyclonal Antibody
AP23117PU-N

USD 440.00

2 Weeks

GABA A Receptor alpha 3 (GABRA3) (480-492) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Bovine, Equine, Hamster, Human, Monkey, Mouse, Rabbit, Rat
Immunogen Synthetic peptide from C-Terminus of human GABRA3 (NP_000799.1)
GABA A Receptor alpha 3 (GABRA3) Rabbit Polyclonal Antibody
TA323565

USD 345.00

4 Weeks

Anti-Gabra3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa. 33~37(R-R-Q-E-P)derived from Rat GABA A Receptor a3.
GABA A Receptor alpha 3 (GABRA3) Rabbit Polyclonal Antibody
TA330435

USD 310.00

5 Days

Rabbit Polyclonal Anti-GABRA3 Antibody

Applications IHC
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the N terminal of human GABRA3. Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL
GABA A Receptor alpha 3 (GABRA3) Rabbit Polyclonal Antibody
TA338501

USD 375.00

5 Days

Rabbit Polyclonal Anti-Gabra3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gabra3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gabra3. Synthetic peptide located within the following region: LLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIF
GABA A Receptor alpha 3 (GABRA3) ICC Control Block
TB406286

USD 1,070.00

4 Weeks

Transient overexpression of GABRA3 (NM_000808) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GABA A Receptor alpha 3 (GABRA3) Cytosection
TS406286

USD 225.00

4 Weeks

Transient overexpression of GABRA3 (NM_000808) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GABA A Receptor alpha 3 (GABRA3) Cytosection
TS406286P5

USD 889.00

4 Weeks

Transient overexpression of GABRA3 (NM_000808) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack