Germany
Japan
United Kingdom
China
NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C1B (GFP-tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NT5C1B (mGFP-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (mGFP-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (mGFP-tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (mGFP-tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 5, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 5, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (mGFP-tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NT5C1B (mGFP-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5C1B (mGFP-tagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NT5C1B (GFP-tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C1B (GFP-tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C1B (GFP-tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C1B (GFP-tagged) - Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C1B (untagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-NT5C1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C1B antibody: synthetic peptide directed towards the N terminal of human NT5C1B. Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT |
Transient overexpression lysate of 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
NT5C1B (NT5C1B-RDH14) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 10-40aa) of human NT5C1B. |
Transient overexpression lysate of 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
NT5C1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C1B (untagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of NT5C1B (NM_001002006) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_033253) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_001199086) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_001199088) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_001199087) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_001002006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C1B (NM_001002006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NT5C1B (NM_033253) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C1B (NM_033253) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NT5C1B (NM_001199086) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- NT5C1B
Pathways
- Nicotinate and nicotinamide metabolism