Products

cDNA Clones (29)
Antibodies (17)
Proteins (15)
Jump to Filters
View as table Download
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone
RC203854

USD 98.00

USD 390.00

In Stock

RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NORE1 (RASSF5) (NM_182664) Human Tagged ORF Clone
RC224073

USD 420.00

In Stock

RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone
RG215017

USD 460.00

In Stock

RASSF5 (GFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone Lentiviral Particle
RC203854L1V

USD 820.00

3 Weeks

Lenti ORF particles, RASSF5 (Myc-DDK tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone Lentiviral Particle
RC203854L2V

USD 820.00

6 Weeks

Lenti ORF particles, RASSF5 (mGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone Lentiviral Particle
RC215017L1V

USD 820.00

3 Weeks

Lenti ORF particles, RASSF5 (Myc-DDK tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone Lentiviral Particle
RC215017L2V

USD 820.00

6 Weeks

Lenti ORF particles, RASSF5 (mGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone
RC215017

USD 420.00

In Stock

RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone
RG203854

USD 460.00

In Stock

RASSF5 (GFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone
RC203854L3

USD 620.00

3 Weeks

Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone Lentiviral Particle
RC203854L3V

USD 820.00

5 Weeks

Lenti ORF particles, RASSF5 (Myc-DDK tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone
RC203854L4

USD 620.00

3 Weeks

Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone Lentiviral Particle
RC203854L4V

USD 820.00

7 Weeks

Lenti ORF particles, RASSF5 (mGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone
RC215017L3

USD 620.00

3 Weeks

Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone Lentiviral Particle
RC215017L3V

USD 820.00

5 Weeks

Lenti ORF particles, RASSF5 (Myc-DDK tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone
RC215017L4

USD 620.00

3 Weeks

Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone Lentiviral Particle
RC215017L4V

USD 820.00

7 Weeks

Lenti ORF particles, RASSF5 (mGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182664) Human Tagged ORF Clone
RC224073L3

USD 620.00

3 Weeks

Lenti-ORF clone of RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182664) Human Tagged ORF Clone Lentiviral Particle
RC224073L3V

USD 820.00

6 Weeks

Lenti ORF particles, RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182664) Human Tagged ORF Clone
RC224073L4

USD 620.00

3 Weeks

Lenti-ORF clone of RASSF5 (mGFP-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182664) Human Tagged ORF Clone Lentiviral Particle
RC224073L4V

USD 820.00

6 Weeks

Lenti ORF particles, RASSF5 (mGFP-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NORE1 (RASSF5) (NM_182664) Human Tagged ORF Clone
RG224073

USD 460.00

3 Weeks

RASSF5 (GFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NORE1 (RASSF5) (NM_182665) Human Untagged Clone
SC324315

USD 420.00

In Stock

RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone
RC203854L1

USD 768.00

In Stock

Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone
RC203854L2

USD 620.00

3 Weeks

Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NORE1 (RASSF5) (NM_182663) Human Tagged ORF Clone
RC215017L2

USD 620.00

3 Weeks

Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NORE1 (RASSF5) (NM_182665) Human Over-expression Lysate
LC405440

USD 121.00

In Stock

RASSF5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NORE1 (RASSF5) Rabbit Polyclonal Antibody
TA309829

USD 350.00

5 Days

Rabbit Polyclonal NORE1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Residues 313-329 [DNPQKFALFKRIHKDGQ] of the NORE1 protein. This sequence is located in the RA domain of NORE1.
NORE1 (RASSF5) Rabbit Polyclonal Antibody
TA342689

USD 375.00

5 Days

Rabbit Polyclonal Anti-RASSF5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rassf5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rassf5. Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK
NORE1 (RASSF5) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
CF502434

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NORE1 (RASSF5) Mouse Monoclonal Antibody [Clone ID: OTI1A11]
CF502508

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NORE1 (RASSF5) Mouse Monoclonal Antibody [Clone ID: OTI1H2]
CF502509

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NORE1 (RASSF5) (NM_182664) Human Over-expression Lysate
LC405439

USD 121.00

2 Weeks

RASSF5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NORE1 (RASSF5) (NM_182664) Human Over-expression Lysate
LY405439

USD 396.00

5 Days

Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NORE1 (RASSF5) (NM_182665) Human Over-expression Lysate
LY405440

USD 396.00

5 Days

Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NORE1 (RASSF5) (NM_182665) Human Mass Spec Standard
PH303854

USD 2,055.00

3 Weeks

RASSF5 MS Standard C13 and N15-labeled recombinant protein (NP_872606)

Tag C-Myc/DDK
Expression Host HEK293
NORE1 (RASSF5) (NM_182665) Human Untagged Clone
SC107439

USD 420.00

4 Weeks

RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NORE1 (RASSF5) (NM_182663) Human Untagged Clone
SC307476

USD 710.00

3 Weeks

RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
NORE1 (RASSF5) (NM_182664) Human Untagged Clone
SC307477

USD 580.00

3 Weeks

RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
NORE1 (RASSF5) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
TA502434

USD 379.00

In Stock

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NORE1 (RASSF5) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
TA502434S

USD 159.00

2 Days

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NORE1 (RASSF5) Mouse Monoclonal Antibody [Clone ID: OTI1A11]
TA502508

USD 379.00

In Stock

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NORE1 (RASSF5) Mouse Monoclonal Antibody [Clone ID: OTI1A11]
TA502508S

USD 159.00

2 Days

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NORE1 (RASSF5) Mouse Monoclonal Antibody [Clone ID: OTI1H2]
TA502509

USD 379.00

In Stock

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NORE1 (RASSF5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H2]
TA502509AM

USD 420.00

4 Weeks

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2), Biotinylated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin