Products

cDNA Clones (24)
Proteins (14)
Antibodies (8)
Jump to Filters
View as table Download
CDC27 (NM_001114091) Human Tagged ORF Clone
RC226198

USD 920.00

In Stock

CDC27 (Myc-DDK-tagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDC27 (NM_001256) Human Tagged ORF Clone
RC213034

USD 1,360.00

In Stock

CDC27 (Myc-DDK-tagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDC27 (NM_001114091) Human Tagged ORF Clone Lentiviral Particle
RC226198L1V

USD 1,320.00

3 Weeks

Lenti ORF particles, CDC27 (Myc-DDK tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CDC27 (NM_001114091) Human Tagged ORF Clone Lentiviral Particle
RC226198L2V

USD 1,320.00

6 Weeks

Lenti ORF particles, CDC27 (mGFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CDC27 (NM_001256) Human Tagged ORF Clone
RG213034

USD 1,500.00

In Stock

CDC27 (GFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC27 (NM_001256) Human Tagged ORF Clone
RC213034L3

USD 1,560.00

3 Weeks

Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC27 (NM_001256) Human Tagged ORF Clone Lentiviral Particle
RC213034L3V

USD 1,760.00

6 Weeks

Lenti ORF particles, CDC27 (Myc-DDK tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC27 (NM_001256) Human Tagged ORF Clone
RC213034L4

USD 1,560.00

3 Weeks

Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC27 (NM_001256) Human Tagged ORF Clone Lentiviral Particle
RC213034L4V

USD 1,760.00

6 Weeks

Lenti ORF particles, CDC27 (mGFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC27 (NM_001114091) Human Tagged ORF Clone
RC226198L3

USD 1,120.00

3 Weeks

Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC27 (NM_001114091) Human Tagged ORF Clone Lentiviral Particle
RC226198L3V

USD 1,320.00

5 Weeks

Lenti ORF particles, CDC27 (Myc-DDK tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC27 (NM_001114091) Human Tagged ORF Clone
RC226198L4

USD 1,120.00

3 Weeks

Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC27 (NM_001114091) Human Tagged ORF Clone Lentiviral Particle
RC226198L4V

USD 1,320.00

7 Weeks

Lenti ORF particles, CDC27 (mGFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC27 (NM_001293091) Human Tagged ORF Clone
RC239512

USD 610.00

3 Weeks

CDC27 (myc-DDK-tagged) - Human cell division cycle 27 (CDC27), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC27 (NM_001293089) Human Tagged ORF Clone
RC239636

USD 610.00

3 Weeks

CDC27 (myc-DDK-tagged) - Human cell division cycle 27 (CDC27), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC27 (NM_001114091) Human Tagged ORF Clone
RG226198

USD 1,010.00

3 Weeks

CDC27 (GFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC27 Rabbit Polyclonal Antibody
TA349015

USD 484.00

5 Days

Rabbit Polyclonal Anti-APC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC3 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human APC3.
CDC27 (NM_001114091) Human Tagged ORF Clone
RC226198L1

USD 1,120.00

In Stock

Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CDC27 (NM_001114091) Human Untagged Clone
SC318990

USD 1,690.00

In Stock

CDC27 (untagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CDC27 (C-term) Rabbit Polyclonal Antibody
AP23516PU-N

USD 525.00

2 Weeks

CDC27 (C-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen CDC27 antibody was raised against synthetic peptide - KLH conjugated
CDC27 (NM_001114091) Human Tagged ORF Clone
RC226198L2

USD 1,120.00

3 Weeks

Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CDC27 (NM_001256) Human Untagged Clone
SC119338

USD 1,670.00

In Stock

CDC27 (untagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CDC27 Rabbit Polyclonal Antibody
TA313394

USD 345.00

In Stock

Rabbit polyclonal anti-H-NUC antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human H-NUC.
CDC27 Rabbit Polyclonal Antibody
AP06780PU-N

USD 407.00

2 Weeks

CDC27 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 360-410 of Human Cdc27.
CDC27 (NM_001256) Human Over-expression Lysate
LC400504

USD 187.00

In Stock

CDC27 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CDC27 (NM_001114091) Human Over-expression Lysate
LC426445

USD 187.00

In Stock

CDC27 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC27 (NM_001256) Human Over-expression Lysate
LY400504

USD 605.00

5 Days

Transient overexpression lysate of cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC27 Rabbit Polyclonal Antibody
TA319297

USD 530.00

5 Days

Rabbit polyclonal CDC27 phospho T244 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 239-249 of Human CDC27.
CDC27 Rabbit Polyclonal Antibody
TA332147

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDC27 Antibody: synthetic peptide directed towards the middle region of human CDC27. Synthetic peptide located within the following region: KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST
CDC27 Rabbit Polyclonal Antibody
TA342554

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC27 antibody is: synthetic peptide directed towards the C-terminal region of Human CDC27. Synthetic peptide located within the following region: SYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSF
CDC27 (NM_001114091) Human Over-expression Lysate
LY426445

USD 605.00

5 Days

Transient overexpression lysate of cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC27 (NM_001293091) Human Tagged ORF Clone
RG239512

USD 650.00

2 Weeks

CDC27 (GFP-tagged) - Human cell division cycle 27 (CDC27), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC27 (NM_001293089) Human Tagged ORF Clone
RG239636

USD 650.00

2 Weeks

CDC27 (GFP-tagged) - Human cell division cycle 27 (CDC27), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC27 (NM_001293091) Human Untagged Clone
SC337406

USD 770.00

3 Weeks

CDC27 (untagged) - Human cell division cycle 27 (CDC27), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CDC27 (NM_001293089) Human Untagged Clone
SC337530

USD 830.00

3 Weeks

CDC27 (untagged) - Human cell division cycle 27 (CDC27), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CDC27 Rabbit Polyclonal Antibody
TA351061

USD 345.00

In Stock

Rabbit Polyclonal Anti-CDC27 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC27
CDC27 ICC Control Block
TB413034

USD 2,010.00

4 Weeks

Transient overexpression of CDC27 (NM_001256) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDC27 ICC Control Block
TB426198

USD 1,570.00

4 Weeks

Transient overexpression of CDC27 (NM_001114091) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDC27 ICC Control Block
TB439512

USD 1,260.00

4 Weeks

Transient overexpression of CDC27 (NM_001293091) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDC27 ICC Control Block
TB439636

USD 1,260.00

4 Weeks

Transient overexpression of CDC27 (NM_001293089) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDC27 Cytosection
TS413034

USD 225.00

4 Weeks

Transient overexpression of CDC27 (NM_001256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CDC27 Cytosection
TS413034P5

USD 889.00

4 Weeks

Transient overexpression of CDC27 (NM_001256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CDC27 Cytosection
TS426198

USD 225.00

4 Weeks

Transient overexpression of CDC27 (NM_001114091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CDC27 Cytosection
TS426198P5

USD 889.00

4 Weeks

Transient overexpression of CDC27 (NM_001114091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CDC27 ICC Control Sections
TS439512P5

USD 889.00

4 Weeks

Transient overexpression of CDC27 (NM_001293091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CDC27 ICC Control Sections
TS439636P5

USD 889.00

4 Weeks

Transient overexpression of CDC27 (NM_001293089) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack