PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP2R5E (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPP2R5E (myc-DDK-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5E (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5E (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP2R5E (myc-DDK-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5E (myc-DDK-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5E (myc-DDK-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PPP2R5E (untagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ppp2r5e antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP |
Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R5E antibody: synthetic peptide directed towards the N terminal of human PPP2R5E. Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK |
Lenti-ORF clone of PPP2R5E (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5E (untagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PPP2R5E (untagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PPP2R5E (untagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PPP2R5E (untagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of PPP2R5E (NM_006246) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2R5E (NM_001282181) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2R5E (NM_001282182) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2R5E (NM_001282180) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2R5E (NM_001282179) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2R5E (NM_006246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP2R5E (NM_006246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP2R5E (NM_001282181) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP2R5E (NM_001282182) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP2R5E (NM_001282180) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP2R5E (NM_001282179) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP2R5E (NM_001282179) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack