Products

View as table Download

PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PPP2R5E (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PPP2R5E (myc-DDK-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PPP2R5E (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R5E (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPP2R5E (myc-DDK-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5E (myc-DDK-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5E (myc-DDK-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PPP2R5E (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

PPP2R5E (untagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
SC127995 is the updated version of SC127994.

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp2r5e antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5E antibody: synthetic peptide directed towards the N terminal of human PPP2R5E. Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK

Lenti-ORF clone of PPP2R5E (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5E (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5E (untagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

PPP2R5E (untagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

PPP2R5E (untagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

PPP2R5E (untagged) - Human protein phosphatase 2, regulatory subunit B', epsilon isoform (PPP2R5E), transcript variant 2

Vector pCMV6 series
Tag Tag Free

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R5E (NM_006246) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R5E (NM_001282181) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R5E (NM_001282182) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R5E (NM_001282180) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R5E (NM_001282179) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PPP2R5E (NM_006246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PPP2R5E (NM_006246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PPP2R5E (NM_001282181) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PPP2R5E (NM_001282182) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PPP2R5E (NM_001282180) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of PPP2R5E (NM_001282179) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PPP2R5E (NM_001282179) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack