Products

cDNA Clones (18)
Proteins (14)
Antibodies (6)
Jump to Filters
View as table Download
ACAA1 (NM_001607) Human Tagged ORF Clone
RC200213

USD 98.00

USD 560.00

In Stock

ACAA1 (Myc-DDK-tagged)-Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACAA1 (NM_001130410) Human Tagged ORF Clone
RC225481

USD 420.00

In Stock

ACAA1 (Myc-DDK-tagged)-Human acetyl-CoA acyltransferase 1 (ACAA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACAA1 (NM_001607) Human Recombinant Protein
TP300213

USD 823.00

In Stock

Recombinant protein of human acetyl-Coenzyme A acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

ACAA1 (NM_001607) Human Tagged ORF Clone Lentiviral Particle
RC200213L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, ACAA1 (Myc-DDK tagged) - Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ACAA1 (NM_001607) Human Tagged ORF Clone Lentiviral Particle
RC200213L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, ACAA1 (mGFP-tagged) - Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ACAA1 (NM_001607) Human Tagged ORF Clone
RG200213

USD 460.00

In Stock

ACAA1 (GFP-tagged) - Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACAA1 (NM_001607) Human Tagged Lenti ORF Clone
RC200213L3

USD 768.00

3 Weeks

Lenti ORF clone of Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAA1 (NM_001607) Human Tagged ORF Clone Lentiviral Particle
RC200213L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, ACAA1 (Myc-DDK tagged) - Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAA1 (NM_001607) Human Tagged Lenti ORF Clone
RC200213L4

USD 768.00

3 Weeks

Lenti ORF clone of Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAA1 (NM_001607) Human Tagged ORF Clone Lentiviral Particle
RC200213L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, ACAA1 (mGFP-tagged) - Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAA1 (NM_001130410) Human Tagged ORF Clone
RC225481L3

USD 620.00

3 Weeks

Lenti-ORF clone of ACAA1 (Myc-DDK-tagged)-Human acetyl-CoA acyltransferase 1 (ACAA1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAA1 (NM_001130410) Human Tagged ORF Clone Lentiviral Particle
RC225481L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACAA1 (Myc-DDK-tagged)-Human acetyl-CoA acyltransferase 1 (ACAA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAA1 (NM_001130410) Human Tagged ORF Clone
RC225481L4

USD 620.00

3 Weeks

Lenti-ORF clone of ACAA1 (mGFP-tagged)-Human acetyl-CoA acyltransferase 1 (ACAA1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAA1 (NM_001130410) Human Tagged ORF Clone Lentiviral Particle
RC225481L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACAA1 (mGFP-tagged)-Human acetyl-CoA acyltransferase 1 (ACAA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAA1 (NM_001130410) Human Tagged ORF Clone
RG225481

USD 460.00

3 Weeks

ACAA1 (GFP-tagged) - Human acetyl-CoA acyltransferase 1 (ACAA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACAA1 (NM_001607) Human Tagged Lenti ORF Clone
RC200213L1

USD 768.00

In Stock

Lenti ORF clone of Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ACAA1 Rabbit Polyclonal Antibody
TA346554

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACAA1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
ACAA1 (NM_001607) Human Tagged Lenti ORF Clone
RC200213L2

USD 768.00

3 Weeks

Lenti ORF clone of Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ACAA1 (NM_001607) Human Untagged Clone
SC319355

USD 310.00

In Stock

ACAA1 (untagged)-Human acetyl-CoA acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ACAA1 (NM_001130410) Human Over-expression Lysate
LC427202

USD 121.00

In Stock

ACAA1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACAA1 (NM_001130410) Human Over-expression Lysate
LY427202

USD 396.00

In Stock

Transient overexpression lysate of acetyl-Coenzyme A acyltransferase 1 (ACAA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACAA1 (27-424, His-tag) Human Protein
AR09612PU-L

USD 845.00

2 Weeks

ACAA1 (27-424, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
ACAA1 (27-424, His-tag) Human Protein
AR09612PU-N

USD 330.00

2 Weeks

ACAA1 (27-424, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
ACAA1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]
CF811054

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ACAA1 (NM_001607) Human Over-expression Lysate
LC400605

USD 121.00

2 Weeks

ACAA1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
ACAA1 (NM_001607) Human Over-expression Lysate
LY400605

USD 396.00

5 Days

Transient overexpression lysate of acetyl-Coenzyme A acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACAA1 (NM_001607) Human Mass Spec Standard
PH300213

USD 2,055.00

3 Weeks

ACAA1 MS Standard C13 and N15-labeled recombinant protein (NP_001598)

Tag C-Myc/DDK
Expression Host HEK293
ACAA1 (NM_001130410) Human Untagged Clone
SC324948

USD 660.00

3 Weeks

ACAA1 (untagged)-Human acetyl-CoA acyltransferase 1 (ACAA1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ACAA1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]
TA811054

USD 379.00

In Stock

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ACAA1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]
TA811054S

USD 159.00

2 Days

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ACAA1 ICC Control Block
TB400213

USD 1,210.00

4 Weeks

Transient overexpression of ACAA1 (NM_001607) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACAA1 ICC Control Block
TB425481

USD 1,070.00

4 Weeks

Transient overexpression of ACAA1 (NM_001130410) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACAA1 Cytosection
TS400213

USD 225.00

4 Weeks

Transient overexpression of ACAA1 (NM_001607) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACAA1 Cytosection
TS400213P5

USD 889.00

4 Weeks

Transient overexpression of ACAA1 (NM_001607) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ACAA1 Cytosection
TS425481

USD 225.00

4 Weeks

Transient overexpression of ACAA1 (NM_001130410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACAA1 Cytosection
TS425481P5

USD 889.00

4 Weeks

Transient overexpression of ACAA1 (NM_001130410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack