Germany
Japan
United Kingdom
China
ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ACOX3 (Myc-DDK tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ACOX3 (mGFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ACOX3 (GFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACOX3 (Myc-DDK tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACOX3 (mGFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ACOX3 (mGFP-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACOX3 (mGFP-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACOX3 (GFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of acyl-Coenzyme A oxidase 3, pristanoyl (ACOX3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ACOX3 (untagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ACOX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT |
ACOX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
ACOX3 MS Standard C13 and N15-labeled recombinant protein (NP_003492)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ACOX3 (untagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Anti-ACOX3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl |
Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACOX3 (NM_001101667) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACOX3 (NM_001101667) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ACOX3
Pathways
- PPAR signaling pathway