Germany
Japan
United Kingdom
China
SCD (Myc-DDK-tagged)-Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SCD (untagged)-Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, SCD (mGFP-tagged) - Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, SCD (Myc-DDK tagged) - Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
SCD (GFP-tagged) - Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, SCD (Myc-DDK tagged) - Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SCD (mGFP-tagged) - Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of stearoyl-CoA desaturase (delta-9-desaturase) (SCD)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-SCD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
SCD1 (SCD) mouse monoclonal antibody, clone CD.E10, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse |
Lenti ORF clone of Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SCD1 (SCD) (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
| Immunogen | Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3. |
SCD HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 206 of rat SCD |
Rabbit Polyclonal Anti-SCD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SCD |
Transient overexpression of SCD (NM_005063) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SCD (NM_005063) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SCD (NM_005063) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SCD
Pathways
- PPAR signaling pathway