Products

cDNA Clones (10)
Antibodies (6)
Proteins (3)
Jump to Filters
View as table Download
Dopamine Transporter (SLC6A3) (NM_001044) Human Tagged ORF Clone
RC219466

USD 480.00

In Stock

SLC6A3 (Myc-DDK-tagged)-Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Dopamine Transporter (SLC6A3) (NM_001044) Human Untagged Clone
SC302961

USD 760.00

In Stock

SLC6A3 (untagged)-Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Dopamine Transporter (SLC6A3) (NM_001044) Human Tagged ORF Clone
RG219466

USD 530.00

In Stock

SLC6A3 (GFP-tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dopamine Transporter (SLC6A3) (NM_001044) Human Tagged ORF Clone Lentiviral Particle
RC219466L1V

USD 880.00

3 Weeks

Lenti ORF particles, SLC6A3 (Myc-DDK tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Dopamine Transporter (SLC6A3) (NM_001044) Human Tagged ORF Clone Lentiviral Particle
RC219466L3V

USD 880.00

5 Weeks

Lenti ORF particles, SLC6A3 (Myc-DDK tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dopamine Transporter (SLC6A3) (NM_001044) Human Tagged ORF Clone
RC219466L4

USD 680.00

In Stock

Lenti ORF clone of Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Dopamine Transporter (SLC6A3) (NM_001044) Human Tagged ORF Clone Lentiviral Particle
RC219466L4V

USD 880.00

3 Weeks

Lenti ORF particles, SLC6A3 (mGFP-tagged) - Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Dopamine Transporter (SLC6A3) Goat Polyclonal Antibody
TA311170

USD 375.00

5 Days

Goat Anti-SLC6A3 / DAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLTSSTLTNPRQSP, from the internal region (near N Terminus) of the protein sequence according to NP_001035.1.
Dopamine Transporter (SLC6A3) (NM_001044) Human Tagged ORF Clone
RC219466L1

USD 680.00

In Stock

Lenti ORF clone of Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Dopamine Transporter (SLC6A3) (NM_001044) Human Tagged ORF Clone
RC219466L2

USD 680.00

3 Weeks

Lenti ORF clone of Human solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 (SLC6A3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Dopamine Transporter (SLC6A3) Rabbit Polyclonal Antibody
TA309111

USD 415.00

5 Days

Rabbit Anti-Dopamine Transporter, C-Terminus, Human Antibody

Applications WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH
Dopamine Transporter (SLC6A3) Rabbit Polyclonal Antibody
TA309112

USD 415.00

5 Days

Rabbit Anti-Dopamine Transporter, Extracellular Loop 2, Human Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region conjugated to KLH
Dopamine Transporter (SLC6A3) Rabbit Polyclonal Antibody
TA334127

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC6A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH
Dopamine Transporter (SLC6A3) Rabbit Polyclonal Antibody
TA350649

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC6A3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC6A3
Dopamine Transporter (SLC6A3) ICC Control Block
TB419466

USD 1,130.00

4 Weeks

Transient overexpression of SLC6A3 (NM_001044) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Dopamine Transporter (SLC6A3) Cytosection
TS419466

USD 225.00

4 Weeks

Transient overexpression of SLC6A3 (NM_001044) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Dopamine Transporter (SLC6A3) Cytosection
TS419466P5

USD 889.00

4 Weeks

Transient overexpression of SLC6A3 (NM_001044) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack