Products

cDNA Clones (11)
Antibodies (10)
Proteins (10)
Jump to Filters
View as table Download
RALB (NM_002881) Human Tagged ORF Clone
RC201982

USD 98.00

USD 390.00

In Stock

RALB (Myc-DDK-tagged)-Human v-ral simian leukemia viral oncogene homolog B (ras related, GTP binding protein) (RALB)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RALB (NM_002881) Human Tagged ORF Clone Lentiviral Particle
RC201982L1V

USD 820.00

3 Weeks

Lenti ORF particles, RALB (Myc-DDK tagged) - Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
RALB (NM_002881) Human Tagged ORF Clone Lentiviral Particle
RC201982L2V

USD 820.00

6 Weeks

Lenti ORF particles, RALB (mGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
RALB (NM_002881) Human Tagged ORF Clone
RG201982

USD 460.00

In Stock

RALB (GFP-tagged) - Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RALB (NM_002881) Human Tagged ORF Clone
RC201982L4

USD 620.00

In Stock

Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RALB (NM_002881) Human Tagged ORF Clone
RC201982L3

USD 620.00

3 Weeks

Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RALB (NM_002881) Human Tagged ORF Clone Lentiviral Particle
RC201982L3V

USD 820.00

5 Weeks

Lenti ORF particles, RALB (Myc-DDK tagged) - Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RALB (NM_002881) Human Tagged ORF Clone Lentiviral Particle
RC201982L4V

USD 820.00

3 Weeks

Lenti ORF particles, RALB (mGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RALB (NM_002881) Human Tagged Lenti ORF Clone
RC201982L1

USD 768.00

In Stock

Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RALB (NM_002881) Human Untagged Clone
SC118324

USD 310.00

In Stock

RALB (untagged)-Human v-ral simian leukemia viral oncogene homolog B (ras related, GTP binding protein) (RALB)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RALB Mouse Monoclonal Antibody [Clone ID: 4D1]
AM31039PU-N

USD 480.00

2 Weeks

RALB mouse monoclonal antibody, clone 4D1, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
RALB (NM_002881) Human Over-expression Lysate
LY419049

USD 396.00

In Stock

Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RALB (NM_002881) Human Tagged ORF Clone
RC201982L2

USD 620.00

3 Weeks

Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RALB (NM_002881) Human Over-expression Lysate
LC419049

USD 121.00

In Stock

RALB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RALB Rabbit Polyclonal Antibody
TA308189

USD 415.00

5 Days

Rabbit polyclonal antibody to RALB (v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALB (Uniprot ID#P11234)
RALB Rabbit Polyclonal Antibody
TA342185

USD 375.00

5 Days

Rabbit polyclonal Anti-RALB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RALB antibody: synthetic peptide directed towards the middle region of human RALB. Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE
RALB Human Protein
AR00160PU-N

USD 400.00

5 Days

RALB human recombinant protein, 25 µg

RALB (1-203, His-tag) Human Protein
AR09779PU-L

USD 1,105.00

2 Weeks

RALB (1-203, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
RALB (1-203, His-tag) Human Protein
AR09779PU-N

USD 415.00

2 Weeks

RALB (1-203, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
RALB Mouse Monoclonal Antibody [Clone ID: OTI2C4]
CF505880

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
RALB (NM_002881) Human Mass Spec Standard
PH301982

USD 2,055.00

3 Weeks

RALB MS Standard C13 and N15-labeled recombinant protein (NP_002872)

Tag C-Myc/DDK
Expression Host HEK293
RALB Rabbit Polyclonal Antibody
TA322938

USD 345.00

In Stock

Anti-RALB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 142-156 amino acids of Human Ras-related protein Ral-B
RALB Rabbit Polyclonal Antibody
TA322939

USD 345.00

In Stock

Anti-RALB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 142-156 amino acids of Human Ras-related protein Ral-B
RALB Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA505880

USD 379.00

In Stock

RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
RALB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C4]
TA505880BM

USD 420.00

5 Days

RALB mouse monoclonal antibody,clone 2C4, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP
RALB Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA505880S

USD 159.00

In Stock

RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
RALB ICC Control Block
TB401982

USD 1,040.00

4 Weeks

Transient overexpression of RALB (NM_002881) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RALB Cytosection
TS401982

USD 225.00

4 Weeks

Transient overexpression of RALB (NM_002881) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RALB Cytosection
TS401982P5

USD 889.00

4 Weeks

Transient overexpression of RALB (NM_002881) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack