Products

Primary Antibodies (35)
View as table Download

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

PAH Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PAH

Goat Polyclonal Antibody against GOT1 (Internal region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1.

Rabbit Polyclonal Anti-GOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Rabbit polyclonal GOT2 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2.

TAT (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 285~315 amino acids from the Central region of human TAT

Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat
Conjugation Unconjugated
Immunogen Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%).

Rabbit polyclonal anti-IL4I1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1.

Rabbit Polyclonal TAT Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

PAH rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Goat Polyclonal Antibody against GOT2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNLKKEGSTHNWQH, from the internal region of the protein sequence according to NP_002071.2.

Goat Anti-Phenylalanine Hydroxylase (PAH) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ESRPSRLKKDE, from the internal region of the protein sequence according to NP_000268.1.

Rabbit anti-GOT1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GOT1

Aspartate Aminotransferase (GOT1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human GOT1

Goat Polyclonal Antibody against GOT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1.

Goat Polyclonal Antibody against GOT2 (Internal Region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CKDADEAKRVES, from the internal region of the protein sequence according to NP_002071.2.

GOT2 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (QGYRYYDPKTCGFD)

Rabbit Polyclonal Anti-GOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA

Rabbit Polyclonal Anti-GOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA

Rabbit Polyclonal Anti-IL4I1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS

Carrier-free (BSA/glycerol-free) TAT mouse monoclonal antibody,clone OTI3G6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAH mouse monoclonal antibody,clone OTI4F6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Modification

Carrier-free (BSA/glycerol-free) PAH mouse monoclonal antibody,clone OTI8A7

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT1

Rabbit Polyclonal Anti-GOT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT2

GOT2 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GOT2

TAT mouse monoclonal antibody,clone OTI3G6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAT mouse monoclonal antibody,clone OTI3G6, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TAT mouse monoclonal antibody,clone OTI3G6, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TAT mouse monoclonal antibody,clone OTI3G6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAH mouse monoclonal antibody,clone OTI4F6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Modification

PAH mouse monoclonal antibody,clone OTI4F6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Modification

PAH mouse monoclonal antibody,clone OTI8A7

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

PAH mouse monoclonal antibody,clone OTI8A7

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated