Products

Antibodies (11)
cDNA Clones (7)
Proteins (6)
Jump to Filters
View as table Download
KIAA1970 (EARS2) (NM_001083614) Human Tagged ORF Clone
RC221871

USD 480.00

In Stock

EARS2 (Myc-DDK-tagged)-Human glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KIAA1970 (EARS2) (NM_001083614) Human Tagged ORF Clone
RC221871L3

USD 680.00

3 Weeks

Lenti ORF clone of Human glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KIAA1970 (EARS2) (NM_001083614) Human Tagged ORF Clone Lentiviral Particle
RC221871L3V

USD 880.00

6 Weeks

Lenti ORF particles, EARS2 (Myc-DDK tagged) - Human glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KIAA1970 (EARS2) (NM_001083614) Human Tagged ORF Clone
RC221871L4

USD 680.00

3 Weeks

Lenti ORF clone of Human glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KIAA1970 (EARS2) (NM_001083614) Human Tagged ORF Clone Lentiviral Particle
RC221871L4V

USD 880.00

6 Weeks

Lenti ORF particles, EARS2 (mGFP-tagged) - Human glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KIAA1970 (EARS2) (NM_001083614) Human Tagged ORF Clone
RG221871

USD 530.00

3 Weeks

EARS2 (GFP-tagged) - Human glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KIAA1970 (EARS2) (NM_001083614) Human Recombinant Protein
TP760688

USD 215.00

In Stock

Purified recombinant protein of Human glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
KIAA1970 (EARS2) Rabbit Polyclonal Antibody
TA339988

USD 375.00

5 Days

Rabbit Polyclonal Anti-EARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EARS2 antibody: synthetic peptide directed towards the middle region of human EARS2. Synthetic peptide located within the following region: TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL
KIAA1970 (EARS2) Mouse Monoclonal Antibody [Clone ID: OTI2B1]
CF810468

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EARS2 mouse monoclonal antibody,clone OTI2B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KIAA1970 (EARS2) Mouse Monoclonal Antibody [Clone ID: OTI2C1]
CF810522

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EARS2 mouse monoclonal antibody,clone OTI2C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KIAA1970 (EARS2) (NM_001083614) Human Over-expression Lysate
LC421237

USD 187.00

2 Weeks

EARS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KIAA1970 (EARS2) (NM_001083614) Human Over-expression Lysate
LY421237

USD 605.00

5 Days

Transient overexpression lysate of glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KIAA1970 (EARS2) (NM_001083614) Human Untagged Clone
SC316061

USD 890.00

3 Weeks

EARS2 (untagged)-Human glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
KIAA1970 (EARS2) Mouse Monoclonal Antibody [Clone ID: OTI2B1]
TA810468

USD 379.00

In Stock

EARS2 mouse monoclonal antibody,clone OTI2B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KIAA1970 (EARS2) Mouse Monoclonal Antibody [Clone ID: OTI2B1]
TA810468S

USD 159.00

2 Days

EARS2 mouse monoclonal antibody,clone OTI2B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KIAA1970 (EARS2) Mouse Monoclonal Antibody [Clone ID: OTI2C1]
TA810522

USD 379.00

In Stock

EARS2 mouse monoclonal antibody,clone OTI2C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KIAA1970 (EARS2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C1]
TA810522AM

USD 420.00

4 Weeks

EARS2 mouse monoclonal antibody,clone OTI2C1, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
KIAA1970 (EARS2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C1]
TA810522BM

USD 420.00

4 Weeks

EARS2 mouse monoclonal antibody,clone OTI2C1, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
KIAA1970 (EARS2) Mouse Monoclonal Antibody [Clone ID: OTI2C1]
TA810522S

USD 159.00

2 Days

EARS2 mouse monoclonal antibody,clone OTI2C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KIAA1970 (EARS2) (NM_001083614) ICC Control Block
TB421871

USD 1,130.00

4 Weeks

Transient overexpression of EARS2 (NM_001083614) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KIAA1970 (EARS2) Cytosection
TS421871

USD 225.00

4 Weeks

Transient overexpression of EARS2 (NM_001083614) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KIAA1970 (EARS2) Cytosection
TS421871P5

USD 889.00

4 Weeks

Transient overexpression of EARS2 (NM_001083614) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack