Germany
Japan
United Kingdom
China
CIITA (Myc-DDK-tagged)-Human class II, major histocompatibility complex, transactivator (CIITA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CIITA (GFP-tagged) - Human class II, major histocompatibility complex, transactivator (CIITA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CIITA (Myc-DDK tagged) - Human class II, major histocompatibility complex, transactivator (CIITA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CIITA (mGFP-tagged) - Human class II, major histocompatibility complex, transactivator (CIITA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, CIITA (Myc-DDK tagged) - Human class II, major histocompatibility complex, transactivator (CIITA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CIITA (mGFP-tagged) - Human class II, major histocompatibility complex, transactivator (CIITA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CIITA (myc-DDK-tagged) - Human class II, major histocompatibility complex, transactivator (CIITA), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CIITA (myc-DDK-tagged) - Human class II, major histocompatibility complex, transactivator (CIITA), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human class II, major histocompatibility complex, transactivator (CIITA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human class II, major histocompatibility complex, transactivator (CIITA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human class II, major histocompatibility complex, transactivator (CIITA), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of class II, major histocompatibility complex, transactivator (CIITA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-CIITA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen used for this study was a bacterially produced recombinant FLAG-CIITA corresponding to amino acids 1 through 333 of the human protein. |
CIITA (N-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
CIITA (untagged)-Human class II, major histocompatibility complex, transactivator (CIITA)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-CIITA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CIITA. |
CIITA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CIITA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIITA antibody: synthetic peptide directed towards the middle region of human CIITA. Synthetic peptide located within the following region: YNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR |
CIITA rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Carrier-free (BSA/glycerol-free) CIITA mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Lenti ORF clone of Human class II, major histocompatibility complex, transactivator (CIITA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
CIITA (GFP-tagged) - Human class II, major histocompatibility complex, transactivator (CIITA), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CIITA (GFP-tagged) - Human class II, major histocompatibility complex, transactivator (CIITA), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CIITA (untagged) - Human class II, major histocompatibility complex, transactivator (CIITA), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CIITA (untagged) - Human class II, major histocompatibility complex, transactivator (CIITA), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CIITA mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CIITA mouse monoclonal antibody,clone OTI7B12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
CIITA mouse monoclonal antibody,clone OTI7B12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CIITA mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of CIITA (NM_000246) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CIITA (NM_001286403) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CIITA (NM_001286402) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CIITA (NM_000246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CIITA (NM_000246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CIITA (NM_001286403) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CIITA (NM_001286402) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CIITA
Pathways
- Primary immunodeficiency