CDC27 (Myc-DDK-tagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC27 (Myc-DDK-tagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC27 (Myc-DDK-tagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDC27 (Myc-DDK tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CDC27 (mGFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CDC27 (GFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC27 (Myc-DDK tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC27 (mGFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC27 (Myc-DDK tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC27 (mGFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDC27 (myc-DDK-tagged) - Human cell division cycle 27 (CDC27), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC27 (myc-DDK-tagged) - Human cell division cycle 27 (CDC27), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC27 (GFP-tagged) - Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-APC3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC3 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human APC3. |
Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CDC27 (untagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CDC27 (C-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CDC27 antibody was raised against synthetic peptide - KLH conjugated |
Lenti ORF clone of Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CDC27 (untagged)-Human cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-H-NUC antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human H-NUC. |
CDC27 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 360-410 of Human Cdc27. |
CDC27 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
CDC27 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal CDC27 phospho T244 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 239-249 of Human CDC27. |
Rabbit Polyclonal Anti-CDC27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CDC27 Antibody: synthetic peptide directed towards the middle region of human CDC27. Synthetic peptide located within the following region: KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST |
Rabbit Polyclonal Anti-CDC27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC27 antibody is: synthetic peptide directed towards the C-terminal region of Human CDC27. Synthetic peptide located within the following region: SYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSF |
Transient overexpression lysate of cell division cycle 27 homolog (S. cerevisiae) (CDC27), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CDC27 (GFP-tagged) - Human cell division cycle 27 (CDC27), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC27 (GFP-tagged) - Human cell division cycle 27 (CDC27), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC27 (untagged) - Human cell division cycle 27 (CDC27), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CDC27 (untagged) - Human cell division cycle 27 (CDC27), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CDC27 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC27 |
Transient overexpression of CDC27 (NM_001256) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC27 (NM_001114091) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC27 (NM_001293091) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC27 (NM_001293089) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC27 (NM_001256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC27 (NM_001256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CDC27 (NM_001114091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC27 (NM_001114091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CDC27 (NM_001293091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CDC27 (NM_001293089) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack