Germany
Japan
United Kingdom
China
PDPK1 (Myc-DDK-tagged)-Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PDPK1 (Myc-DDK-tagged)-Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
PDPK1 (GFP-tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, PDPK1 (Myc-DDK tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PDPK1 (mGFP-tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, PDPK1 (Myc-DDK tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PDPK1 (mGFP-tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PDPK1 (GFP-tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PDPK1 (Myc-DDK tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PDPK1 (mGFP-tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PDPK1 (Myc-DDK tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PDPK1 (mGFP-tagged) - Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PDPK1 (Myc-DDK tagged) - Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDPK1 (GFP-tagged) - Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PDPK1 (untagged)-Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC118544 is the updated version of SC118543.
Transient overexpression lysate of 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit anti-PDPK1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human PDPK1 |
Transient overexpression lysate of 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal PDK1 (Tyr9) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PDK1 around the phosphorylation site of tyrosine 9 (Q-L-YP-D-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PDK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 |
Rabbit Polyclonal PDK1 (Ser241) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 around the phosphorylation site of Serine 241 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PDPK1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
PDPK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PDPK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
(untagged)-Human cDNA FLJ31691 fis, clone NT2RI2005628
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-PDK1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminal of human PDK-1 protein. |
Rabbit Polyclonal anti-PDPK1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDPK1 antibody: synthetic peptide directed towards the middle region of human PDPK1. Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS |
PDPK1 MS Standard C13 and N15-labeled recombinant protein (NP_112558)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PDPK1 (untagged)-Human 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PDPK1 (untagged) - Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of PDPK1 (NM_031268) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDPK1 (NM_002613) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDPK1 (NM_001261816) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDPK1 (NM_031268) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDPK1 (NM_031268) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDPK1 (NM_002613) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDPK1 (NM_002613) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDPK1 (NM_001261816) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PDPK1
Pathways
- Prostate cancer