Products

cDNA Clones (26)
Antibodies (13)
Proteins (13)
Jump to Filters
View as table Download
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260

USD 98.00

USD 390.00

In Stock

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSMA1 (NM_002786) Human Tagged ORF Clone Lentiviral Particle
RC203260L1V

USD 820.00

3 Weeks

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone Lentiviral Particle
RC203260L2V

USD 820.00

In Stock

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone
RC211847

USD 420.00

In Stock

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 (NM_002786) Human Tagged ORF Clone
RG203260

USD 460.00

In Stock

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone Lentiviral Particle
RC203260L3V

USD 820.00

5 Weeks

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone Lentiviral Particle
RC203260L4V

USD 820.00

7 Weeks

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone
RC211847L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone Lentiviral Particle
RC211847L3V

USD 820.00

6 Weeks

Lenti ORF particles, PSMA1 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone
RC211847L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone Lentiviral Particle
RC211847L4V

USD 820.00

6 Weeks

Lenti ORF particles, PSMA1 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone
RC226679

USD 420.00

2 Weeks

PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone
RC226679L3

USD 620.00

8 Weeks

Lenti-ORF clone of PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone Lentiviral Particle
RC226679L3V

USD 820.00

11 Weeks

Lenti ORF particles, PSMA1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone
RC226679L4

USD 620.00

8 Weeks

Lenti-ORF clone of PSMA1 (mGFP-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone Lentiviral Particle
RC226679L4V

USD 820.00

11 Weeks

Lenti ORF particles, PSMA1 (mGFP-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA1 (NM_148976) Human Tagged ORF Clone
RG211847

USD 460.00

3 Weeks

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 (NM_001143937) Human Tagged ORF Clone
RG226679

USD 460.00

3 Weeks

PSMA1 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA1 Rabbit Polyclonal Antibody
TA345809

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
PSMA1 (NM_002786) Human Recombinant Protein
TP760007

USD 215.00

In Stock

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260L1

USD 620.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PSMA1 (NM_002786) Human Tagged ORF Clone
RC203260L2

USD 620.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PSMA1 Rabbit Polyclonal Antibody
TA332538

USD 275.00

3 Weeks

Rabbit anti-PSMA1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMA1
PSMA1 (NM_002786) Human Over-expression Lysate
LY419114

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMA1 Rabbit Polyclonal Antibody
TA345810

USD 410.00

5 Days

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the N terminal of human PSMA1. Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK
PSMA1 (NM_002786) Human Untagged Clone
SC109640

USD 420.00

In Stock

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC109640 is the updated version of SC125401.
PSMA1 (NM_002786) Human Untagged Clone
SC320849

USD 420.00

In Stock

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PSMA1 (1-263, His-tag) Human Protein
AR50066PU-N

USD 845.00

2 Weeks

PSMA1 (1-263, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
PSMA1 (1-263, His-tag) Human Protein
AR50066PU-S

USD 330.00

2 Weeks

PSMA1 (1-263, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]
CF812757

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI6C4]
CF812761

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 (NM_002786) Human Over-expression Lysate
LC419114

USD 121.00

2 Weeks

PSMA1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMA1 (NM_148976) Human Untagged Clone
SC306348

USD 660.00

3 Weeks

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PSMA1 (NM_001143937) Human Untagged Clone
SC325490

USD 420.00

2 Weeks

PSMA1 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 1 (PSMA1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]
TA812757

USD 379.00

In Stock

PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]
TA812757S

USD 159.00

2 Days

PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI6C4]
TA812761

USD 379.00

In Stock

PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI6C4]
TA812761S

USD 159.00

2 Days

PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 ICC Control Block
TB403260

USD 1,040.00

4 Weeks

Transient overexpression of PSMA1 (NM_002786) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSMA1 ICC Control Block
TB411847

USD 1,070.00

4 Weeks

Transient overexpression of PSMA1 (NM_148976) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSMA1 ICC Control Block
TB426679

USD 1,070.00

4 Weeks

Transient overexpression of PSMA1 (NM_001143937) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSMA1 Cytosection
TS403260

USD 225.00

4 Weeks

Transient overexpression of PSMA1 (NM_002786) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PSMA1 Cytosection
TS403260P5

USD 889.00

4 Weeks

Transient overexpression of PSMA1 (NM_002786) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PSMA1 Cytosection
TS411847

USD 225.00

4 Weeks

Transient overexpression of PSMA1 (NM_148976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack