Germany
Japan
United Kingdom
China
PSMC5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PSMC5 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PSMC5 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PSMC5 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, PSMC5 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PSMC5 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PSMC5 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMC5 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PSMC5 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-PSMC5 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMC5 Antibody: synthetic peptide directed towards the C terminal of human PSMC5. Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK |
PSMC5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
(untagged)-Human cDNA FLJ25618 fis, clone STM02139, highly similar to 26S PROTEASE REGULATORY SUBUNIT 8
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PSMC5 MS Standard C13 and N15-labeled recombinant protein (NP_002796)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PSMC5 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of PSMC5 (NM_002805) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMC5 (NM_001199163) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMC5 (NM_002805) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSMC5 (NM_002805) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSMC5 (NM_001199163) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PSMC5
Pathways
- Proteasome