Products

cDNA Clones (18)
Proteins (13)
Antibodies (1)
Jump to Filters
View as table Download
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Tagged ORF Clone
RC223917

USD 420.00

In Stock

DGUOK (Myc-DDK-tagged)-Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Recombinant Protein
TP304891

USD 823.00

4 Weeks

Recombinant protein of human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone Lentiviral Particle
RC204891L1V

USD 820.00

3 Weeks

Lenti ORF particles, DGUOK (Myc-DDK tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone Lentiviral Particle
RC204891L2V

USD 820.00

6 Weeks

Lenti ORF particles, DGUOK (mGFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone
RG204891

USD 460.00

In Stock

DGUOK (GFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Tagged ORF Clone
RG223917

USD 460.00

In Stock

DGUOK (GFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone
RC204891L3

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone Lentiviral Particle
RC204891L3V

USD 820.00

5 Weeks

Lenti ORF particles, DGUOK (Myc-DDK tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone
RC204891L4

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone Lentiviral Particle
RC204891L4V

USD 820.00

7 Weeks

Lenti ORF particles, DGUOK (mGFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Tagged ORF Clone
RC223917L3

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Tagged ORF Clone Lentiviral Particle
RC223917L3V

USD 820.00

6 Weeks

Lenti ORF particles, DGUOK (Myc-DDK tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Tagged ORF Clone
RC223917L4

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Tagged ORF Clone Lentiviral Particle
RC223917L4V

USD 820.00

6 Weeks

Lenti ORF particles, DGUOK (mGFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone
RC204891L1

USD 768.00

In Stock

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Untagged Clone
SC321455

USD 660.00

In Stock

DGUOK (untagged)-Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Recombinant Protein
TP760996

USD 215.00

In Stock

Purified recombinant protein of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Tagged ORF Clone
RC204891L2

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Over-expression Lysate
LY409002

USD 396.00

5 Days

Transient overexpression lysate of deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Untagged Clone
SC124293

USD 420.00

In Stock

DGUOK (untagged)-Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Deoxyguanosine kinase (DGUOK) Rabbit Polyclonal Antibody
TA337928

USD 375.00

5 Days

Rabbit Polyclonal Anti-DGUOK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGUOK antibody is: synthetic peptide directed towards the C-terminal region of Human DGUOK. Synthetic peptide located within the following region: EQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMRE
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Over-expression Lysate
LC409002

USD 121.00

2 Weeks

DGUOK HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Over-expression Lysate
LC409003

USD 121.00

2 Weeks

DGUOK HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Deoxyguanosine kinase (DGUOK) (NM_080918) Human Over-expression Lysate
LY409003

USD 396.00

5 Days

Transient overexpression lysate of deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Mass Spec Standard
PH304891

USD 2,055.00

3 Weeks

DGUOK MS Standard C13 and N15-labeled recombinant protein (NP_550438)

Tag C-Myc/DDK
Expression Host HEK293
Deoxyguanosine kinase (DGUOK) ICC Control Block
TB404891

USD 1,070.00

4 Weeks

Transient overexpression of DGUOK (NM_080916) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Deoxyguanosine kinase (DGUOK) ICC Control Block
TB423917

USD 1,070.00

4 Weeks

Transient overexpression of DGUOK (NM_080918) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Deoxyguanosine kinase (DGUOK) Cytosection
TS404891

USD 225.00

4 Weeks

Transient overexpression of DGUOK (NM_080916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Deoxyguanosine kinase (DGUOK) Cytosection
TS404891P5

USD 889.00

4 Weeks

Transient overexpression of DGUOK (NM_080916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Deoxyguanosine kinase (DGUOK) Cytosection
TS423917

USD 225.00

4 Weeks

Transient overexpression of DGUOK (NM_080918) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Deoxyguanosine kinase (DGUOK) Cytosection
TS423917P5

USD 889.00

4 Weeks

Transient overexpression of DGUOK (NM_080918) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack