Products

cDNA Clones (31)
Antibodies (18)
Proteins (16)
Jump to Filters
View as table Download
PDE1A (NM_005019) Human Tagged ORF Clone
RC205292

USD 420.00

In Stock

PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PDE1A (NM_005019) Human Tagged ORF Clone Lentiviral Particle
RC205292L1V

USD 820.00

3 Weeks

Lenti ORF particles, PDE1A (Myc-DDK tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PDE1A (NM_005019) Human Tagged ORF Clone Lentiviral Particle
RC205292L2V

USD 820.00

6 Weeks

Lenti ORF particles, PDE1A (mGFP-tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PDE1A (NM_001003683) Human Tagged ORF Clone Lentiviral Particle
RC223864L1V

USD 880.00

3 Weeks

Lenti ORF particles, PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PDE1A (NM_001003683) Human Tagged ORF Clone Lentiviral Particle
RC223864L2V

USD 880.00

6 Weeks

Lenti ORF particles, PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PDE1A (NM_005019) Human Tagged ORF Clone
RG205292

USD 460.00

In Stock

PDE1A (GFP-tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_001003683) Human Tagged ORF Clone
RC223864

USD 480.00

In Stock

PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_005019) Human Tagged ORF Clone
RC205292L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1A (NM_005019) Human Tagged ORF Clone Lentiviral Particle
RC205292L3V

USD 820.00

5 Weeks

Lenti ORF particles, PDE1A (Myc-DDK tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1A (NM_005019) Human Tagged ORF Clone
RC205292L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1A (NM_005019) Human Tagged ORF Clone Lentiviral Particle
RC205292L4V

USD 820.00

7 Weeks

Lenti ORF particles, PDE1A (mGFP-tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1A (NM_001003683) Human Tagged ORF Clone
RC223864L3

USD 680.00

3 Weeks

Lenti-ORF clone of PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1A (NM_001003683) Human Tagged ORF Clone Lentiviral Particle
RC223864L3V

USD 880.00

7 Weeks

Lenti ORF particles, PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1A (NM_001003683) Human Tagged ORF Clone
RC223864L4

USD 680.00

3 Weeks

Lenti-ORF clone of PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1A (NM_001003683) Human Tagged ORF Clone Lentiviral Particle
RC223864L4V

USD 880.00

7 Weeks

Lenti ORF particles, PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1A (NM_001258314) Human Tagged ORF Clone
RC234298

USD 480.00

5 Weeks

PDE1A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_001258313) Human Tagged ORF Clone
RC234336

USD 480.00

2 Weeks

PDE1A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_001258312) Human Tagged ORF Clone
RC234414

USD 480.00

2 Weeks

PDE1A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_001003683) Human Tagged ORF Clone
RG223864

USD 530.00

3 Weeks

PDE1A (GFP-tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_001258314) Human Tagged ORF Clone
RG234298

USD 530.00

5 Weeks

PDE1A (GFP-tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_001258313) Human Tagged ORF Clone
RG234336

USD 530.00

5 Weeks

PDE1A (GFP-tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_001258312) Human Tagged ORF Clone
RG234414

USD 530.00

5 Weeks

PDE1A (GFP-tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1A (NM_001003683) Human Tagged Lenti ORF Clone
RC223864L1

USD 840.00

In Stock

Lenti-ORF clone of PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PDE1A (NM_005019) Human Tagged ORF Clone
RC205292L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PDE1A (NM_005019) Human Over-expression Lysate
LY401556

USD 396.00

In Stock

Transient overexpression lysate of phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDE1A (NM_005019) Human Tagged ORF Clone
RC205292L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PDE1A (NM_001003683) Human Tagged ORF Clone
RC223864L2

USD 680.00

3 Weeks

Lenti-ORF clone of PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PDE1A (NM_005019) Human Untagged Clone
SC117012

USD 760.00

In Stock

PDE1A (untagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PDE1A Rabbit Polyclonal Antibody
TA308379

USD 415.00

5 Days

Rabbit Polyclonal antibody to PDE1A (phosphodiesterase 1A, calmodulin-dependent)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 212 and 535 of PDE1A (Uniprot ID#P54750)
PDE1A Goat Polyclonal Antibody
TA311317

USD 375.00

5 Days

Goat Anti-PDE1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DLHKNSEDLVNAE, from the C Terminus of the protein sequence according to NP_005010.2.
PDE1A (NM_005019) Human Over-expression Lysate
LC401556

USD 121.00

In Stock

PDE1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PDE1A Rabbit Polyclonal Antibody
TA335729

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDE1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET
PDE1A Mouse Monoclonal Antibody [Clone ID: OTI5C9]
CF803136

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE1A Mouse Monoclonal Antibody [Clone ID: OTI7D5]
CF803629

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE1A Mouse Monoclonal Antibody [Clone ID: OTI5H4]
CF803635

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE1A (NM_005019) Human Mass Spec Standard
PH305292

USD 2,055.00

3 Weeks

PDE1A MS Standard C13 and N15-labeled recombinant protein (NP_005010)

Tag C-Myc/DDK
Expression Host HEK293
PDE1A (NM_001003683) Human Untagged Clone
SC300512

USD 900.00

3 Weeks

PDE1A (untagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PDE1A (NM_001258312) Human Untagged Clone
SC332655

USD 570.00

5 Weeks

PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 3

Vector pCMV6 series
Tag Tag Free
PDE1A (NM_001258313) Human Untagged Clone
SC332656

USD 530.00

5 Weeks

PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 4

Vector pCMV6 series
Tag Tag Free
PDE1A (NM_001258314) Human Untagged Clone
SC332657

USD 500.00

5 Weeks

PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 5

Vector pCMV6 series
Tag Tag Free
PDE1A Mouse Monoclonal Antibody [Clone ID: OTI5C9]
TA803136

USD 379.00

In Stock

PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE1A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C9]
TA803136AM

USD 420.00

5 Days

PDE1A mouse monoclonal antibody,clone 5C9, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PDE1A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C9]
TA803136BM

USD 420.00

5 Days

PDE1A mouse monoclonal antibody,clone 5C9, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PDE1A Mouse Monoclonal Antibody [Clone ID: OTI5C9]
TA803136S

USD 159.00

2 Days

PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE1A Mouse Monoclonal Antibody [Clone ID: OTI7D5]
TA803629

USD 379.00

In Stock

PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE1A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D5]
TA803629AM

USD 420.00

4 Weeks

PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PDE1A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D5]
TA803629BM

USD 420.00

4 Weeks

PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PDE1A Mouse Monoclonal Antibody [Clone ID: OTI7D5]
TA803629S

USD 159.00

2 Days

PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE1A Mouse Monoclonal Antibody [Clone ID: OTI5H4]
TA803635

USD 379.00

In Stock

PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated