Germany
Japan
United Kingdom
China
NT5M (Myc-DDK-tagged)-Human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
NT5M (GFP-tagged) - Human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5M (Myc-DDK tagged) - Human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NT5M (mGFP-tagged) - Human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-NT5M Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5M antibody: synthetic peptide directed towards the middle region of human NT5M. Synthetic peptide located within the following region: KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV |
Rabbit Polyclonal Anti-NT5M Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5M antibody: synthetic peptide directed towards the N terminal of human NT5M. Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL |
NT5M (untagged)-Human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5M (32-228, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
NT5M (32-228, His-tag) human recombinant protein, 10 µg
| Tag | His-tag |
| Expression Host | E. coli |
NT5M HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5M MS Standard C13 and N15-labeled recombinant protein (NP_064586)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of NT5M (NM_020201) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5M (NM_020201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5M (NM_020201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- NT5M
Pathways
- Pyrimidine metabolism