Products

cDNA Clones (18)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
ME2 (NM_002396) Human Tagged ORF Clone
RC219389

USD 540.00

In Stock

ME2 (Myc-DDK-tagged)-Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ME2 (NM_002396) Human Tagged ORF Clone Lentiviral Particle
RC219389L1V

USD 940.00

3 Weeks

Lenti ORF particles, ME2 (Myc-DDK tagged) - Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ME2 (NM_002396) Human Tagged ORF Clone Lentiviral Particle
RC219389L2V

USD 940.00

6 Weeks

Lenti ORF particles, ME2 (mGFP-tagged) - Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ME2 (NM_001168335) Human Tagged ORF Clone
RG230146

USD 460.00

In Stock

ME2 (GFP-tagged) - Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ME2 (NM_002396) Human Tagged ORF Clone
RG219389

USD 590.00

In Stock

ME2 (GFP-tagged) - Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ME2 (NM_002396) Human Tagged ORF Clone
RC219389L3

USD 740.00

3 Weeks

Lenti ORF clone of Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME2 (NM_002396) Human Tagged ORF Clone Lentiviral Particle
RC219389L3V

USD 940.00

5 Weeks

Lenti ORF particles, ME2 (Myc-DDK tagged) - Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME2 (NM_002396) Human Tagged ORF Clone
RC219389L4

USD 740.00

3 Weeks

Lenti ORF clone of Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME2 (NM_002396) Human Tagged ORF Clone Lentiviral Particle
RC219389L4V

USD 940.00

7 Weeks

Lenti ORF particles, ME2 (mGFP-tagged) - Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME2 (NM_001168335) Human Tagged ORF Clone
RC230146

USD 420.00

3 Weeks

ME2 (Myc-DDK-tagged)-Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ME2 (NM_001168335) Human Tagged ORF Clone
RC230146L3

USD 620.00

3 Weeks

Lenti-ORF clone of ME2 (Myc-DDK-tagged)-Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME2 (NM_001168335) Human Tagged ORF Clone Lentiviral Particle
RC230146L3V

USD 820.00

6 Weeks

Lenti ORF particles, ME2 (Myc-DDK-tagged)-Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME2 (NM_001168335) Human Tagged ORF Clone
RC230146L4

USD 620.00

3 Weeks

Lenti-ORF clone of ME2 (mGFP-tagged)-Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME2 (NM_001168335) Human Tagged ORF Clone Lentiviral Particle
RC230146L4V

USD 820.00

6 Weeks

Lenti ORF particles, ME2 (mGFP-tagged)-Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME2 (NM_002396) Human Tagged ORF Clone
RC219389L1

USD 912.00

In Stock

Lenti ORF clone of Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ME2 (NM_002396) Human Untagged Clone
SC118666

USD 1,000.00

In Stock

ME2 (untagged)-Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ME2 (NM_002396) Human Tagged ORF Clone
RC219389L2

USD 740.00

3 Weeks

Lenti ORF clone of Human malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ME2 (C-term) Rabbit Polyclonal Antibody
AP52647PU-N

USD 450.00

2 Weeks

ME2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 526-556 amino acids from the C-terminal region of Human NAD-ME
ME2 (NM_002396) Human Over-expression Lysate
LY419348

USD 605.00

In Stock

Transient overexpression lysate of malic enzyme 2, NAD(+)-dependent, mitochondrial (ME2), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ME2 Rabbit Polyclonal Antibody
TA339737

USD 375.00

5 Days

Rabbit Polyclonal Anti-ME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ME2 antibody: synthetic peptide directed towards the N terminal of human ME2. Synthetic peptide located within the following region: MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG
ME2 (NM_002396) Human Over-expression Lysate
LC419348

USD 187.00

2 Weeks

ME2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ME2 (NM_002396) Human Mass Spec Standard
PH319389

USD 2,055.00

3 Weeks

ME2 MS Standard C13 and N15-labeled recombinant protein (NP_002387)

Tag C-Myc/DDK
Expression Host HEK293
ME2 (NM_001168335) Human Untagged Clone
SC328784

USD 760.00

3 Weeks

ME2 (untagged)-Human malic enzyme 2 NAD(+)-dependent mitochondrial (ME2) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ME2 ICC Control Block
TB419389

USD 1,190.00

4 Weeks

Transient overexpression of ME2 (NM_002396) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ME2 ICC Control Block
TB430146

USD 1,070.00

4 Weeks

Transient overexpression of ME2 (NM_001168335) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ME2 Cytosection
TS419389

USD 225.00

4 Weeks

Transient overexpression of ME2 (NM_002396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ME2 Cytosection
TS419389P5

USD 889.00

4 Weeks

Transient overexpression of ME2 (NM_002396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ME2 ICC Control Sections
TS430146P5

USD 889.00

4 Weeks

Transient overexpression of ME2 (NM_001168335) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack