Products

View as table Download

IFNA4 (Myc-DDK-tagged)-Human interferon, alpha 4 (IFNA4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

IFNA4 (GFP-tagged) - Human interferon, alpha 4 (IFNA4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human interferon, alpha 4 (IFNA4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 4 (IFNA4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

IFNA4 (untagged)-Human interferon, alpha 4 (IFNA4)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human interferon, alpha 4 (IFNA4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Purified recombinant protein of Human interferon, alpha 4 (IFNA4)

Tag C-His
Expression Host HEK293

IFNA4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of interferon, alpha 4 (IFNA4)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit polyclonal IFNA4 Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4.

Rabbit Polyclonal Anti-IFNA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

IFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_066546)

Tag C-Myc/DDK
Expression Host HEK293

USD 1,070.00

4 Weeks

Transient overexpression of IFNA4 (NM_021068) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human interferon, alpha 4 (IFNA4)

Tag C-His
Expression Host HEK293

Purified recombinant protein of Human interferon, alpha 4 (IFNA4)

Tag C-His
Expression Host HEK293

Purified recombinant protein of Human interferon, alpha 4 (IFNA4)

Tag C-His
Expression Host HEK293

USD 225.00

4 Weeks

Transient overexpression of IFNA4 (NM_021068) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of IFNA4 (NM_021068) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack