IFNA4 Rabbit Polyclonal Antibody

CAT#: TA343040

Rabbit Polyclonal Anti-IFNA4 Antibody

Product Images

WB Suggested Anti-IFNA4 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: interferon, alpha 4
• Database Link:
  NP_066546
  Entrez Gene 3441 Human
  UniProt ID P05014
• Background: IFNA4 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Synonyms: IFN-alpha4a; INFA4
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 83%; Goat: 83%; Sheep: 83%; Bovine: 83%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway