Products

cDNA Clones (11)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
RNF125 (NM_017831) Human Tagged ORF Clone
RC204578

USD 98.00

USD 390.00

In Stock

RNF125 (Myc-DDK-tagged)-Human ring finger protein 125 (RNF125)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RNF125 (NM_017831) Human Tagged ORF Clone
RG204578

USD 460.00

In Stock

RNF125 (GFP-tagged) - Human ring finger protein 125 (RNF125)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RNF125 (NM_017831) Human Tagged ORF Clone
RC204578L4

USD 620.00

In Stock

Lenti ORF clone of Human ring finger protein 125 (RNF125), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RNF125 (NM_017831) Human Tagged ORF Clone
RC204578L1

USD 768.00

In Stock

Lenti ORF clone of Human ring finger protein 125 (RNF125), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RNF125 Rabbit Polyclonal Antibody
TA329868

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-RNF125 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF125 antibody: synthetic peptide directed towards the middle region of human RNF125. Synthetic peptide located within the following region: ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH
RNF125 (NM_017831) Human Over-expression Lysate
LC413505

USD 121.00

In Stock

RNF125 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RNF125 (NM_017831) Human Tagged ORF Clone
RC204578L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ring finger protein 125 (RNF125), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RNF125 (NM_017831) Human Untagged Clone
SC321663

USD 420.00

In Stock

RNF125 (untagged)-Human ring finger protein 125 (RNF125)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
RNF125 (NM_017831) Human Over-expression Lysate
LY413505

USD 396.00

In Stock

Transient overexpression lysate of ring finger protein 125 (RNF125)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RNF125 Rabbit Polyclonal Antibody
TA315551

USD 345.00

4 Weeks

Rabbit polyclonal anti-RNF125 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RNF125.
RNF125 (NM_017831) ICC Control Block
TB404578

USD 1,040.00

4 Weeks

Transient overexpression of RNF125 (NM_017831) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RNF125 Cytosection
TS404578

USD 225.00

4 Weeks

Transient overexpression of RNF125 (NM_017831) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RNF125 Cytosection
TS404578P5

USD 889.00

4 Weeks

Transient overexpression of RNF125 (NM_017831) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack