RNF125 (Myc-DDK-tagged)-Human ring finger protein 125 (RNF125)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RNF125 (Myc-DDK-tagged)-Human ring finger protein 125 (RNF125)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, RNF125 (Myc-DDK tagged) - Human ring finger protein 125 (RNF125), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, RNF125 (mGFP-tagged) - Human ring finger protein 125 (RNF125), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
RNF125 (GFP-tagged) - Human ring finger protein 125 (RNF125)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ring finger protein 125 (RNF125), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RNF125 (Myc-DDK tagged) - Human ring finger protein 125 (RNF125), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RNF125 (mGFP-tagged) - Human ring finger protein 125 (RNF125), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ring finger protein 125 (RNF125), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ring finger protein 125 (RNF125), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RNF125 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RNF125 antibody: synthetic peptide directed towards the middle region of human RNF125. Synthetic peptide located within the following region: ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH |
RNF125 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human ring finger protein 125 (RNF125), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RNF125 (untagged)-Human ring finger protein 125 (RNF125)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of ring finger protein 125 (RNF125)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-RNF125 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RNF125. |
Transient overexpression of RNF125 (NM_017831) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RNF125 (NM_017831) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RNF125 (NM_017831) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack