Products

cDNA Clones (10)
Antibodies (5)
Proteins (5)
Jump to Filters
View as table Download
DCP2 (NM_152624) Human Tagged ORF Clone
RG221165

USD 460.00

In Stock

DCP2 (GFP-tagged) - Human DCP2 decapping enzyme homolog (S. cerevisiae) (DCP2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP2 (NM_152624) Human Tagged ORF Clone
RC221165

USD 420.00

In Stock

DCP2 (Myc-DDK-tagged)-Human DCP2 decapping enzyme homolog (S. cerevisiae) (DCP2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP2 (NM_152624) Human Tagged ORF Clone Lentiviral Particle
RC221165L3V

USD 820.00

6 Weeks

Lenti ORF particles, DCP2 (Myc-DDK-tagged)-Human DCP2 decapping enzyme homolog (S. cerevisiae) (DCP2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DCP2 (NM_152624) Human Tagged ORF Clone
RC221165L4

USD 620.00

3 Weeks

Lenti-ORF clone of DCP2 (mGFP-tagged)-Human DCP2 decapping enzyme homolog (S. cerevisiae) (DCP2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DCP2 (NM_152624) Human Tagged ORF Clone Lentiviral Particle
RC221165L4V

USD 820.00

6 Weeks

Lenti ORF particles, DCP2 (mGFP-tagged)-Human DCP2 decapping enzyme homolog (S. cerevisiae) (DCP2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DCP2 (NM_001242377) Human Tagged ORF Clone
RC232630

USD 420.00

3 Weeks

DCP2 (Myc-DDK tagged) - Homo sapiens decapping mRNA 2 (DCP2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP2 (NM_001242377) Human Tagged ORF Clone
RG232630

USD 460.00

3 Weeks

DCP2 (GFP-tagged) - Homo sapiens decapping mRNA 2 (DCP2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP2 Rabbit Polyclonal Antibody
TA344008

USD 475.00

5 Days

Rabbit Polyclonal Anti-DCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the middle region of human DCP2. Synthetic peptide located within the following region: KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP
DCP2 Rabbit Polyclonal Antibody
TA344009

USD 475.00

5 Days

Rabbit Polyclonal Anti-DCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the C terminal of human DCP2. Synthetic peptide located within the following region: VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK
DCP2 (Center) Rabbit Polyclonal Antibody
AP51202PU-N

USD 450.00

2 Weeks

DCP2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 151~181 amino acids from the Center region of Human DCP2
DCP2 (NM_152624) Human Untagged Clone
SC100774

USD 710.00

In Stock

DCP2 (untagged)-Human DCP2 decapping enzyme homolog (S. cerevisiae) (DCP2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DCP2 Rabbit Polyclonal Antibody
TA320127

USD 430.00

5 Days

Rabbit Polyclonal DCP2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DCP2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DCP2.
DCP2 Rabbit Polyclonal Antibody
TA310110

USD 230.00

3 Weeks

Rabbit anti-DCP2 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
DCP2 (NM_001242377) Human Untagged Clone
SC329943

USD 390.00

3 Weeks

DCP2 (untagged) - Homo sapiens decapping mRNA 2 (DCP2), transcript variant 2

Vector pCMV6 series
Tag Tag Free
DCP2 (NM_152624) ICC Control Block
TB421165

USD 1,070.00

4 Weeks

Transient overexpression of DCP2 (NM_152624) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DCP2 (NM_001242377) ICC Control Block
TB432630

USD 1,070.00

4 Weeks

Transient overexpression of DCP2 (NM_001242377) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DCP2 Cytosection
TS421165

USD 225.00

4 Weeks

Transient overexpression of DCP2 (NM_152624) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DCP2 Cytosection
TS421165P5

USD 889.00

4 Weeks

Transient overexpression of DCP2 (NM_152624) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DCP2 ICC Control Sections
TS432630P5

USD 889.00

4 Weeks

Transient overexpression of DCP2 (NM_001242377) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack