Products

cDNA Clones (18)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
EXOSC10 (NM_001001998) Human Tagged ORF Clone
RC210055

USD 420.00

In Stock

EXOSC10 (Myc-DDK-tagged)-Human exosome component 10 (EXOSC10), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EXOSC10 (NM_001001998) Human Tagged ORF Clone Lentiviral Particle
RC210055L2V

USD 820.00

6 Weeks

Lenti ORF particles, EXOSC10 (mGFP-tagged) - Human exosome component 10 (EXOSC10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EXOSC10 (NM_001001998) Human Tagged ORF Clone
RG210055

USD 460.00

In Stock

EXOSC10 (GFP-tagged) - Human exosome component 10 (EXOSC10), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EXOSC10 (NM_001001998) Human Tagged ORF Clone Lentiviral Particle
RC210055L3V

USD 820.00

5 Weeks

Lenti ORF particles, EXOSC10 (Myc-DDK tagged) - Human exosome component 10 (EXOSC10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC10 (NM_001001998) Human Tagged ORF Clone
RC210055L4

USD 620.00

In Stock

Lenti ORF clone of Human exosome component 10 (EXOSC10), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC10 (NM_001001998) Human Tagged ORF Clone Lentiviral Particle
RC210055L4V

USD 820.00

3 Weeks

Lenti ORF particles, EXOSC10 (mGFP-tagged) - Human exosome component 10 (EXOSC10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC10 (NM_002685) Human Tagged ORF Clone
RC213555

USD 960.00

4 Weeks

EXOSC10 (Myc-DDK-tagged)-Human exosome component 10 (EXOSC10), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EXOSC10 (NM_002685) Human Tagged ORF Clone
RC213555L3

USD 1,160.00

4 Weeks

Lenti-ORF clone of EXOSC10 (Myc-DDK-tagged)-Human exosome component 10 (EXOSC10), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC10 (NM_002685) Human Tagged ORF Clone Lentiviral Particle
RC213555L3V

USD 1,360.00

7 Weeks

Lenti ORF particles, EXOSC10 (Myc-DDK-tagged)-Human exosome component 10 (EXOSC10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC10 (NM_002685) Human Tagged ORF Clone
RC213555L4

USD 1,160.00

4 Weeks

Lenti-ORF clone of EXOSC10 (mGFP-tagged)-Human exosome component 10 (EXOSC10), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC10 (NM_002685) Human Tagged ORF Clone Lentiviral Particle
RC213555L4V

USD 1,360.00

7 Weeks

Lenti ORF particles, EXOSC10 (mGFP-tagged)-Human exosome component 10 (EXOSC10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC10 (NM_002685) Human Tagged ORF Clone
RG213555

USD 1,060.00

5 Weeks

EXOSC10 (GFP-tagged) - Human exosome component 10 (EXOSC10), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EXOSC10 (NM_001001998) Human Tagged ORF Clone
RC210055L1

USD 768.00

In Stock

Lenti ORF clone of Human exosome component 10 (EXOSC10), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EXOSC10 Rabbit Polyclonal Antibody
TA345696

USD 410.00

5 Days

Rabbit Polyclonal Anti-EXOSC10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C terminal of human EXOSC10. Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG
EXOSC10 Rabbit Polyclonal Antibody
TA345697

USD 475.00

5 Days

Rabbit Polyclonal Anti-EXOSC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C-terminal region of human EXOSC10. Synthetic peptide located within the following region: ACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKP
EXOSC10 (NM_001001998) Human Untagged Clone
SC124367

USD 310.00

In Stock

EXOSC10 (untagged)-Human exosome component 10 (EXOSC10), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
EXOSC10 (NM_001001998) Human Tagged ORF Clone
RC210055L2

USD 620.00

3 Weeks

Lenti ORF clone of Human exosome component 10 (EXOSC10), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EXOSC10 (NM_001001998) Human Over-expression Lysate
LY424312

USD 396.00

5 Days

Transient overexpression lysate of exosome component 10 (EXOSC10), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EXOSC10 (NM_002685) Human Untagged Clone
SC118513

USD 1,750.00

In Stock

EXOSC10 (untagged)-Human exosome component 10 (EXOSC10), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
EXOSC10 (NM_001001998) Human Over-expression Lysate
LC424312

USD 121.00

2 Weeks

EXOSC10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EXOSC10 ICC Control Block
TB410055

USD 1,070.00

4 Weeks

Transient overexpression of EXOSC10 (NM_001001998) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EXOSC10 ICC Control Block
TB413555

USD 1,610.00

4 Weeks

Transient overexpression of EXOSC10 (NM_002685) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EXOSC10 Cytosection
TS410055

USD 225.00

4 Weeks

Transient overexpression of EXOSC10 (NM_001001998) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

EXOSC10 Cytosection
TS410055P5

USD 889.00

4 Weeks

Transient overexpression of EXOSC10 (NM_001001998) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

EXOSC10 ICC Control Sections
TS413555P5

USD 889.00

4 Weeks

Transient overexpression of EXOSC10 (NM_002685) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack