EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EXOSC6 (GFP-tagged) - Human exosome component 6 (EXOSC6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-EXOSC6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK |
Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-EXOSC6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG |
Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
EXOSC6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of exosome component 6 (EXOSC6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
EXOSC6 (untagged)-Human exosome component 6 (EXOSC6)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EXOSC6 (untagged)-Human exosome component 6 (EXOSC6)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack