Products

View as table Download

EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

EXOSC6 (GFP-tagged) - Human exosome component 6 (EXOSC6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-EXOSC6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK

Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-EXOSC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG

Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

EXOSC6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

EXOSC6 (untagged)-Human exosome component 6 (EXOSC6)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

EXOSC6 (untagged)-Human exosome component 6 (EXOSC6)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

(untagged)-Human cDNA: FLJ22502 fis, clone HRC11383

Vector pCMV6 series
Tag Tag Free

Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack