Germany
Japan
United Kingdom
China
EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
EXOSC6 (GFP-tagged) - Human exosome component 6 (EXOSC6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-EXOSC6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK |
Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-EXOSC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG |
Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
EXOSC6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of exosome component 6 (EXOSC6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
EXOSC6 (untagged)-Human exosome component 6 (EXOSC6)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
EXOSC6 (untagged)-Human exosome component 6 (EXOSC6)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- EXOSC6
Pathways
- RNA degradation