Products

cDNA Clones (13)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
EXOSC6 (NM_058219) Human Tagged ORF Clone
RC208634

USD 420.00

In Stock

EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EXOSC6 (NM_058219) Human Tagged ORF Clone
RC208634L3

USD 620.00

3 Weeks

Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC6 (NM_058219) Human Tagged ORF Clone
RC208634L4

USD 620.00

3 Weeks

Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC6 (NM_058219) Human Tagged ORF Clone
RG208634

USD 460.00

3 Weeks

EXOSC6 (GFP-tagged) - Human exosome component 6 (EXOSC6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EXOSC6 Rabbit Polyclonal Antibody
TA343971

USD 410.00

5 Days

Rabbit Polyclonal Anti-EXOSC6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK
EXOSC6 (NM_058219) Human Tagged ORF Clone
RC208634L1

USD 620.00

In Stock

Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EXOSC6 Rabbit Polyclonal Antibody
TA343970

USD 475.00

5 Days

Rabbit Polyclonal Anti-EXOSC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG
EXOSC6 (NM_058219) Human Tagged ORF Clone
RC208634L2

USD 620.00

3 Weeks

Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EXOSC6 (NM_058219) Human Over-expression Lysate
LC409238

USD 121.00

In Stock

EXOSC6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EXOSC6 (NM_058219) Human Over-expression Lysate
LY409238

USD 396.00

In Stock

Transient overexpression lysate of exosome component 6 (EXOSC6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EXOSC6 (NM_058219) Human Untagged Clone
SC320513

USD 660.00

In Stock

EXOSC6 (untagged)-Human exosome component 6 (EXOSC6)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
EXOSC6 (NM_058219) Human Untagged Clone
SC120246

USD 660.00

3 Weeks

EXOSC6 (untagged)-Human exosome component 6 (EXOSC6)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
EXOSC6 (AK026155) Human Untagged Clone
SC311964

USD 960.00

3 Weeks

(untagged)-Human cDNA: FLJ22502 fis, clone HRC11383

Vector pCMV6 series
Tag Tag Free
EXOSC6 (NM_058219) ICC Control Block
TB408634

USD 1,070.00

4 Weeks

Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EXOSC6 Cytosection
TS408634

USD 225.00

4 Weeks

Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

EXOSC6 Cytosection
TS408634P5

USD 889.00

4 Weeks

Transient overexpression of EXOSC6 (NM_058219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack