Products

Proteins (7)
cDNA Clones (7)
Antibodies (2)
Jump to Filters
View as table Download
LSM2 (NM_021177) Human Tagged ORF Clone
RC203460

USD 98.00

USD 390.00

In Stock

LSM2 (Myc-DDK-tagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LSM2 (NM_021177) Human Tagged ORF Clone
RG203460

USD 460.00

In Stock

LSM2 (GFP-tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LSM2 (NM_021177) Human Tagged ORF Clone
RC203460L3

USD 620.00

3 Weeks

Lenti ORF clone of Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM2 (NM_021177) Human Tagged ORF Clone Lentiviral Particle
RC203460L3V

USD 820.00

6 Weeks

Lenti ORF particles, LSM2 (Myc-DDK tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM2 (NM_021177) Human Tagged ORF Clone
RC203460L4

USD 620.00

3 Weeks

Lenti ORF clone of Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM2 (NM_021177) Human Tagged ORF Clone Lentiviral Particle
RC203460L4V

USD 820.00

6 Weeks

Lenti ORF particles, LSM2 (mGFP-tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM2 Rabbit Polyclonal Antibody
TA343904

USD 410.00

5 Days

Rabbit Polyclonal Anti-LSM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2. Synthetic peptide located within the following region: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
LSM2 (NM_021177) Human Over-expression Lysate
LC412045

USD 121.00

In Stock

LSM2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LSM2 (NM_021177) Human Untagged Clone
SC112996

USD 310.00

In Stock

LSM2 (untagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
LSM2 Goat Polyclonal Antibody
TA311501

USD 375.00

5 Days

Goat Anti-LSM2 (aa33-46) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DQYLNIKLTDISVT, from the internal region of the protein sequence according to NP_067000.1.
LSM2 (1-95, His-tag) Human Protein
AR50301PU-N

USD 845.00

2 Weeks

LSM2 (1-95, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
LSM2 (1-95, His-tag) Human Protein
AR50301PU-S

USD 330.00

2 Weeks

LSM2 (1-95, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
LSM2 (NM_021177) Human Over-expression Lysate
LY412045

USD 396.00

5 Days

Transient overexpression lysate of LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LSM2 (NM_021177) ICC Control Block
TB403460

USD 1,040.00

4 Weeks

Transient overexpression of LSM2 (NM_021177) in HEK293T cells paraffin embedded controls for ICC/IHC staining

LSM2 Cytosection
TS403460

USD 225.00

4 Weeks

Transient overexpression of LSM2 (NM_021177) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

LSM2 Cytosection
TS403460P5

USD 889.00

4 Weeks

Transient overexpression of LSM2 (NM_021177) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack