Germany
Japan
United Kingdom
China
LSM2 (Myc-DDK-tagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lsm2 (Myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LSM2 (GFP-tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LSM2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN403460 is the updated version of KN203460.
Lsm2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509532 is the updated version of KN309532.
Lsm2 (GFP-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lsm2 (GFP-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Lsm2 (Myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lsm2 (Myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Lsm2 (mGFP-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lsm2 (GFP-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lsm2 (Myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Lsm2 (Myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lsm2 (Myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Lsm2 (mGFP-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lsm2 (GFP-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lsm2 (myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lsm2 (myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LSM2 (Myc-DDK tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LSM2 (mGFP-tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lsm2 (myc-DDK-tagged) - Rat LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lsm2 (myc-DDK-tagged) - Rat LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-LSM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2. Synthetic peptide located within the following region: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
LSM2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lsm2 (untagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 1, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
LSM2 (untagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Anti-LSM2 (aa33-46) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DQYLNIKLTDISVT, from the internal region of the protein sequence according to NP_067000.1. |
LSM2 (1-95, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
LSM2 (1-95, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
LSM2 CRISPRa kit - CRISPR gene activation of human LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Lsm2 CRISPRa kit - CRISPR gene activation of mouse LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene LSM2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene LSM2
Transient overexpression lysate of LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lsm2 (untagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lsm2 (untagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Lsm2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Lsm2
AAV ORF Particles, serotype AAV-2, Lsm2 (Myc-DDK-tagged) - Mouse LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 2, 250ul, >10^13 TU/mL
- AAV ORF®
-
AAV ORF Particles, serotype AAV-2, LSM2 (Myc-DDK-tagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), 250ul, >10^13 TU/mL
- AAV ORF®
-
Lsm2 (untagged) - Rat LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lsm2 (untagged) - Rat LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of LSM2 homolog U6 small nuclear RNA associated (S. cerevisiae) (LSM2) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
LSM2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lsm2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
LSM2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human LSM2 (NP_067000.1). |
| Modifications | Unmodified |
Transient overexpression of LSM2 (NM_021177) in HEK293T cells paraffin embedded controls for ICC/IHC staining
LSM2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- LSM2