Products

cDNA Clones (14)
Proteins (9)
Antibodies (2)
Jump to Filters
View as table Download
GIT1 (NM_014030) Human Tagged ORF Clone
RC220153

USD 850.00

In Stock

GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GIT1 (NM_001085454) Human Tagged ORF Clone
RC224712

USD 860.00

In Stock

GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GIT1 (NM_014030) Human Tagged ORF Clone
RG220153

USD 940.00

In Stock

GIT1 (GFP-tagged) - Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GIT1 (NM_014030) Human Tagged ORF Clone
RC220153L3

USD 1,050.00

3 Weeks

Lenti-ORF clone of GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_014030) Human Tagged ORF Clone Lentiviral Particle
RC220153L3V

USD 1,250.00

6 Weeks

Lenti ORF particles, GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_014030) Human Tagged ORF Clone
RC220153L4

USD 1,050.00

3 Weeks

Lenti-ORF clone of GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_014030) Human Tagged ORF Clone Lentiviral Particle
RC220153L4V

USD 1,250.00

6 Weeks

Lenti ORF particles, GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone
RC224712L3

USD 1,060.00

3 Weeks

Lenti-ORF clone of GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone Lentiviral Particle
RC224712L3V

USD 1,260.00

6 Weeks

Lenti ORF particles, GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone
RC224712L4

USD 1,060.00

3 Weeks

Lenti-ORF clone of GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone Lentiviral Particle
RC224712L4V

USD 1,260.00

6 Weeks

Lenti ORF particles, GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone
RG224712

USD 950.00

3 Weeks

GIT1 (GFP-tagged) - Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GIT1 Rabbit Polyclonal Antibody
TA326288

USD 345.00

In Stock

Rabbit polyclonal GIT1 antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GIT1.
GIT1 Rabbit Polyclonal Antibody
TA343154

USD 375.00

5 Days

Rabbit Polyclonal Anti-GIT1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Git1 antibody is: synthetic peptide directed towards the middle region of Rat Git1. Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE
GIT1 (NM_014030) Human Over-expression Lysate
LC415510

USD 187.00

2 Weeks

GIT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GIT1 (NM_014030) Human Over-expression Lysate
LY415510

USD 605.00

5 Days

Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GIT1 (NM_014030) Human Mass Spec Standard
PH320153

USD 2,055.00

3 Weeks

GIT1 MS Standard C13 and N15-labeled recombinant protein (NP_054749)

Tag C-Myc/DDK
Expression Host HEK293
GIT1 (NM_014030) Human Untagged Clone
SC310126

USD 1,550.00

2 Weeks

GIT1 (untagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SC310126 is the updated version of SC115183.
GIT1 (NM_001085454) Human Untagged Clone
SC316259

USD 1,570.00

5 Weeks

GIT1 (untagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pCMV6 series
Tag Tag Free
GIT1 (NM_014030) ICC Control Block
TB420153

USD 1,500.00

4 Weeks

Transient overexpression of GIT1 (NM_014030) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GIT1 (NM_001085454) ICC Control Block
TB424712

USD 1,510.00

4 Weeks

Transient overexpression of GIT1 (NM_001085454) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GIT1 Cytosection
TS420153

USD 225.00

4 Weeks

Transient overexpression of GIT1 (NM_014030) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GIT1 Cytosection
TS420153P5

USD 889.00

4 Weeks

Transient overexpression of GIT1 (NM_014030) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GIT1 Cytosection
TS424712

USD 225.00

4 Weeks

Transient overexpression of GIT1 (NM_001085454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GIT1 Cytosection
TS424712P5

USD 889.00

4 Weeks

Transient overexpression of GIT1 (NM_001085454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack