Products

cDNA Clones (29)
RNAi (12)
Proteins (10)
Antibodies (6)
Gene Expression (5)
Jump to Filters
View as table Download
Git1 (NM_001004144) Mouse Tagged ORF Clone
MG210556

USD 670.00

In Stock

Git1 (GFP-tagged) - Mouse G protein-coupled receptor kinase-interactor 1 (Git1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GIT1 (NM_014030) Human Tagged ORF Clone
RC220153

USD 850.00

In Stock

GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Git1 (NM_001004144) Mouse Tagged ORF Clone
MR210556

USD 610.00

In Stock

Git1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase-interactor 1 (Git1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GIT1 (NM_001085454) Human Tagged ORF Clone
RC224712

USD 860.00

In Stock

GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GIT1 (NM_014030) Human Tagged ORF Clone
RG220153

USD 940.00

In Stock

GIT1 (GFP-tagged) - Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GIT1 Human Gene Knockout Kit (CRISPR)
KN420153

USD 1,290.00

2 Weeks

GIT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN420153 is the updated version of KN220153.
Git1 Mouse Gene Knockout Kit (CRISPR)
KN506475

USD 1,290.00

2 Weeks

Git1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506475 is the updated version of KN306475.
Git1 (NM_001004144) Mouse Tagged ORF Clone
MR210556L3

USD 810.00

3 Weeks

Lenti ORF clone of Git1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase-interactor 1 (Git1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Git1 (NM_001004144) Mouse Tagged ORF Clone Lentiviral Particle
MR210556L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, Git1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase-interactor 1 (Git1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Git1 (NM_001004144) Mouse Tagged ORF Clone
MR210556L4

USD 810.00

3 Weeks

Lenti ORF clone of Git1 (mGFP-tagged) - Mouse G protein-coupled receptor kinase-interactor 1 (Git1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Git1 (NM_001004144) Mouse Tagged ORF Clone Lentiviral Particle
MR210556L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, Git1 (GFP-tagged) - Mouse G protein-coupled receptor kinase-interactor 1 (Git1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_014030) Human Tagged ORF Clone
RC220153L3

USD 1,050.00

3 Weeks

Lenti-ORF clone of GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_014030) Human Tagged ORF Clone Lentiviral Particle
RC220153L3V

USD 1,250.00

6 Weeks

Lenti ORF particles, GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_014030) Human Tagged ORF Clone
RC220153L4

USD 1,050.00

3 Weeks

Lenti-ORF clone of GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_014030) Human Tagged ORF Clone Lentiviral Particle
RC220153L4V

USD 1,250.00

6 Weeks

Lenti ORF particles, GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone
RC224712L3

USD 1,060.00

3 Weeks

Lenti-ORF clone of GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone Lentiviral Particle
RC224712L3V

USD 1,260.00

6 Weeks

Lenti ORF particles, GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone
RC224712L4

USD 1,060.00

3 Weeks

Lenti-ORF clone of GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone Lentiviral Particle
RC224712L4V

USD 1,260.00

6 Weeks

Lenti ORF particles, GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GIT1 (NM_001085454) Human Tagged ORF Clone
RG224712

USD 950.00

3 Weeks

GIT1 (GFP-tagged) - Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Git1 (NM_031814) Rat Tagged ORF Clone
RR204123

USD 1,040.00

5 Weeks

Git1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase interacting ArfGAP 1 (Git1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Git1 (NM_031814) Rat Tagged ORF Clone
RR204123L3

USD 1,230.00

10 Weeks

Lenti ORF clone of Git1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase interacting ArfGAP 1 (Git1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Git1 (NM_031814) Rat Tagged ORF Clone Lentiviral Particle
RR204123L3V

USD 1,450.00

14 Weeks

Lenti ORF particles, Git1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase interacting ArfGAP 1 (Git1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Git1 (NM_031814) Rat Tagged ORF Clone
RR204123L4

USD 1,350.00

10 Weeks

Lenti ORF clone of Git1 (mGFP-tagged ORF) - Rat G protein-coupled receptor kinase interacting ArfGAP 1 (Git1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Git1 (NM_031814) Rat Tagged ORF Clone Lentiviral Particle
RR204123L4V

USD 1,610.00

14 Weeks

Lenti ORF particles, Git1 (GFP-tagged ORF) - Rat G protein-coupled receptor kinase interacting ArfGAP 1 (Git1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Git1 Rat siRNA Oligo Duplex (Locus ID 83709)
SR503837

USD 430.00

In Stock

Git1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

GIT1 Rabbit Polyclonal Antibody
TA326288

USD 345.00

In Stock

Rabbit polyclonal GIT1 antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GIT1.
Git1 Mouse Monoclonal Antibody [Clone ID: S39B-8]
TA326533

USD 410.00

5 Days

Mouse Monoclonal Anti-GIT1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIT1 Rabbit Polyclonal Antibody
TA343154

USD 375.00

5 Days

Rabbit Polyclonal Anti-GIT1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Git1 antibody is: synthetic peptide directed towards the middle region of Rat Git1. Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE
Human GIT1 activation kit by CRISPRa
GA109173

USD 1,290.00

2 Weeks

GIT1 CRISPRa kit - CRISPR gene activation of human GIT ArfGAP 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
GIT1 Human qPCR Primer Pair (NM_014030)
HP234269

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GIT1

GIT1 (NM_014030) Human Over-expression Lysate
LC415510

USD 187.00

2 Weeks

GIT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GIT1 (NM_014030) Human Over-expression Lysate
LY415510

USD 605.00

5 Days

Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Git1 (NM_001004144) Mouse Untagged Clone
MC221473

USD 1,050.00

5 Weeks

Git1 (untagged) - Mouse G protein-coupled receptor kinase-interactor 1 (Git1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Git1 Mouse qPCR Primer Pair (NM_001004144)
MP205163

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Git1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
GIT1 (NM_014030) Human Mass Spec Standard
PH320153

USD 2,055.00

3 Weeks

GIT1 MS Standard C13 and N15-labeled recombinant protein (NP_054749)

Tag C-Myc/DDK
Expression Host HEK293
Git1 (NM_031814) Rat Untagged Clone
RN204123

USD 1,040.00

6 Weeks

Git1 (untagged ORF) - Rat G protein-coupled receptor kinase interacting ArfGAP 1 (Git1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GIT1 (NM_014030) Human 3' UTR Clone
SC213475

USD 560.00

4 Weeks

3`UTR clone of G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
GIT1 (NM_001085454) Human 3' UTR Clone
SC213476

USD 560.00

4 Weeks

3`UTR clone of G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
GIT1 (NM_014030) Human Untagged Clone
SC310126

USD 1,550.00

2 Weeks

GIT1 (untagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SC310126 is the updated version of SC115183.
GIT1 (NM_001085454) Human Untagged Clone
SC316259

USD 1,570.00

5 Weeks

GIT1 (untagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1

Vector pCMV6 series
Tag Tag Free
GIT1 Human siRNA Oligo Duplex (Locus ID 28964)
SR309140

USD 430.00

2 Weeks

GIT1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Git1 Mouse siRNA Oligo Duplex (Locus ID 216963)
SR419978

USD 430.00

2 Weeks

Git1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

GIT1 Rabbit Polyclonal Antibody
TA359434

USD 360.00

5 Days

GIT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GIT1
GIT1 Rabbit Polyclonal Antibody
TA361274

USD 360.00

5 Days

GIT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GIT1
GIT1 Rabbit Polyclonal Antibody
TA376574

USD 328.00

3 Weeks

GIT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-640 of human GIT1 (NP_054749.2).
Modifications Unmodified
GIT1 (NM_014030) ICC Control Block
TB420153

USD 1,500.00

4 Weeks

Transient overexpression of GIT1 (NM_014030) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GIT1 (NM_001085454) ICC Control Block
TB424712

USD 1,510.00

4 Weeks

Transient overexpression of GIT1 (NM_001085454) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GIT1 Human shRNA Plasmid Kit (Locus ID 28964)
TL312772

USD 815.00

2 Weeks

GIT1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
GIT1 Human shRNA Lentiviral Particle (Locus ID 28964)
TL312772V

USD 1,395.00

5 Weeks

GIT1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti