Products

cDNA Clones (14)
Proteins (5)
Antibodies (4)
Jump to Filters
View as table Download
G protein alpha 13 (GNA13) (NM_006572) Human Tagged ORF Clone
RC207762

USD 420.00

In Stock

GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha 13 (GNA13) (NM_006572) Human Tagged ORF Clone
RG207762

USD 460.00

In Stock

GNA13 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha 13 (GNA13) Rabbit Polyclonal Antibody
TA349321

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-GNA13 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GNA13
G protein alpha 13 (GNA13) (NM_006572) Human Tagged ORF Clone
RC207762L3

USD 620.00

3 Weeks

Lenti-ORF clone of GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha 13 (GNA13) (NM_006572) Human Tagged ORF Clone Lentiviral Particle
RC207762L3V

USD 820.00

7 Weeks

Lenti ORF particles, GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha 13 (GNA13) (NM_006572) Human Tagged ORF Clone
RC207762L4

USD 620.00

3 Weeks

Lenti-ORF clone of GNA13 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha 13 (GNA13) (NM_006572) Human Tagged ORF Clone Lentiviral Particle
RC207762L4V

USD 820.00

7 Weeks

Lenti ORF particles, GNA13 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha 13 (GNA13) (NM_001282425) Human Tagged ORF Clone
RC237150

USD 420.00

2 Weeks

GNA13 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha 13 (GNA13) (NM_006572) Human Untagged Clone
SC116002

USD 760.00

In Stock

GNA13 (untagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
G protein alpha 13 (GNA13) (NM_006572) Human Tagged ORF Clone
RC207762L1

USD 620.00

In Stock

Lenti-ORF clone of GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
G protein alpha 13 (GNA13) Rabbit Polyclonal Antibody
TA332882

USD 374.00

3 Weeks

Rabbit anti-GNA13 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNA13
G protein alpha 13 (GNA13) (NM_006572) Human Tagged ORF Clone
RC207762L2

USD 620.00

3 Weeks

Lenti-ORF clone of GNA13 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
G protein alpha 13 (GNA13) Rabbit Polyclonal Antibody
TA331256

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNA13 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK
G protein alpha 13 (GNA13) Rabbit Polyclonal Antibody
TA331257

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNA13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: SREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTI
G protein alpha 13 (GNA13) (NM_001282425) Human Tagged ORF Clone
RG237150

USD 460.00

2 Weeks

GNA13 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha 13 (GNA13) (NM_001282425) Human Untagged Clone
SC335044

USD 477.00

2 Weeks

GNA13 (untagged) - Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha 13 (GNA13) (NM_006572) ICC Control Block
TB407762

USD 1,070.00

4 Weeks

Transient overexpression of GNA13 (NM_006572) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha 13 (GNA13) (NM_001282425) ICC Control Block
TB437150

USD 1,070.00

4 Weeks

Transient overexpression of GNA13 (NM_001282425) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha 13 (GNA13) Cytosection
TS407762

USD 225.00

4 Weeks

Transient overexpression of GNA13 (NM_006572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

G protein alpha 13 (GNA13) Cytosection
TS407762P5

USD 889.00

4 Weeks

Transient overexpression of GNA13 (NM_006572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

G protein alpha 13 (GNA13) ICC Control Sections
TS437150P5

USD 889.00

4 Weeks

Transient overexpression of GNA13 (NM_001282425) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack