MYH9 (Myc-DDK-tagged)-Human myosin, heavy chain 9, non-muscle (MYH9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
MYH9 (Myc-DDK-tagged)-Human myosin, heavy chain 9, non-muscle (MYH9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MYH9 (GFP-tagged) - Human myosin, heavy chain 9, non-muscle (MYH9)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MYH9 (untagged)-Human myosin, heavy chain 9, non-muscle (MYH9)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MYH9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK |
USD 480.00
2 Weeks
myosin heavy chain 9 (MYH9) mouse monoclonal antibody, clone 2B3, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
myosin heavy chain 9 (MYH9) mouse monoclonal antibody, clone 4H3, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
Lymphotactin (XCL1) (22-114) mouse monoclonal antibody, clone 1E1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Osteopontin (SPP1) mouse monoclonal antibody, clone X1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
(untagged)-Human cDNA: FLJ21740 fis, clone COLF4800, highly similar to HUMMYONM Human nonmuscle myosin heavy chain (NMHC) mRNA
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 235.00
5 Days
Rabbit Polyclonal anti-Myosin heavy chain
Applications | IF |
Reactivities | Human, Rat, reacts against 1960 aa length myosin heavy chain |
Conjugation | Unconjugated |
Immunogen | Recombinant |
Transient overexpression of MYH9 (NM_002473) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYH9 (NM_002473) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYH9 (NM_002473) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack