Products

cDNA Clones (40)
Proteins (25)
Antibodies (2)
Jump to Filters
View as table Download
MYL12B (NM_033546) Human Tagged ORF Clone
RC201372

USD 98.00

USD 390.00

In Stock

MYL12B (Myc-DDK-tagged)-Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MYL12B (NM_001144944) Human Tagged ORF Clone
RC226973

USD 420.00

In Stock

MYL12B (Myc-DDK-tagged)-Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MYL12B (NM_001144945) Human Tagged ORF Clone
RC227002

USD 420.00

In Stock

MYL12B (Myc-DDK-tagged)-Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MYL12B (NM_001144946) Human Tagged ORF Clone
RC227035

USD 420.00

In Stock

MYL12B (Myc-DDK-tagged)-Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MYL12B (NM_033546) Human Tagged ORF Clone Lentiviral Particle
RC201372L1V

USD 820.00

3 Weeks

Lenti ORF particles, MYL12B (Myc-DDK tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MYL12B (NM_033546) Human Tagged ORF Clone Lentiviral Particle
RC201372L2V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (mGFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone Lentiviral Particle
RC226973L1V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (Myc-DDK tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone Lentiviral Particle
RC226973L2V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (mGFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone Lentiviral Particle
RC227002L1V

USD 820.00

4 Weeks

Lenti ORF particles, MYL12B (Myc-DDK tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone Lentiviral Particle
RC227002L2V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (mGFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone
RG226973

USD 460.00

In Stock

MYL12B (GFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MYL12B (NM_033546) Human Tagged ORF Clone
RG201372

USD 460.00

In Stock

MYL12B (GFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MYL12B (NM_033546) Human Tagged ORF Clone
RC201372L3

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_033546) Human Tagged ORF Clone Lentiviral Particle
RC201372L3V

USD 820.00

5 Weeks

Lenti ORF particles, MYL12B (Myc-DDK tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_033546) Human Tagged ORF Clone
RC201372L4

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_033546) Human Tagged ORF Clone Lentiviral Particle
RC201372L4V

USD 820.00

7 Weeks

Lenti ORF particles, MYL12B (mGFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone
RC226973L3

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone Lentiviral Particle
RC226973L3V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (Myc-DDK tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone
RC226973L4

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone Lentiviral Particle
RC226973L4V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (mGFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone
RC227002L3

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone Lentiviral Particle
RC227002L3V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (Myc-DDK tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone
RC227002L4

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone Lentiviral Particle
RC227002L4V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (mGFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144946) Human Tagged ORF Clone
RC227035L3

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144946) Human Tagged ORF Clone Lentiviral Particle
RC227035L3V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (Myc-DDK tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144946) Human Tagged ORF Clone
RC227035L4

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144946) Human Tagged ORF Clone Lentiviral Particle
RC227035L4V

USD 820.00

6 Weeks

Lenti ORF particles, MYL12B (mGFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone
RG227002

USD 460.00

3 Weeks

MYL12B (GFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MYL12B (NM_001144946) Human Tagged ORF Clone
RG227035

USD 460.00

3 Weeks

MYL12B (GFP-tagged) - Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MYL12B (NM_033546) Human Tagged ORF Clone
RC201372L1

USD 768.00

In Stock

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MYL12B (NM_033546) Human Untagged Clone
SC120113

USD 310.00

In Stock

MYL12B (untagged)-Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MYL12B (NM_033546) Human Tagged ORF Clone
RC201372L2

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone
RC226973L1

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MYL12B (NM_001144944) Human Tagged ORF Clone
RC226973L2

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone
RC227002L1

USD 620.00

In Stock

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MYL12B (NM_001144945) Human Tagged ORF Clone
RC227002L2

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MYL12B (NM_033546) Human Over-expression Lysate
LY403261

USD 396.00

5 Days

Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MYL12B (NM_001144944) Human Untagged Clone
SC324759

USD 420.00

5 Days

MYL12B (untagged)-Human myosin, light chain 12B, regulatory (MYL12B), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MYL12B Rabbit Polyclonal Antibody
TA333578

USD 375.00

5 Days

Rabbit Polyclonal Anti-MYL12B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYL12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MYL12B. Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE
MYL12B (1-172, His-tag) Human Protein
AR50401PU-N

USD 845.00

2 Weeks

MYL12B (1-172, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
MYL12B (1-172, His-tag) Human Protein
AR50401PU-S

USD 330.00

2 Weeks

MYL12B (1-172, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
MYL12B (NM_033546) Human Over-expression Lysate
LC403261

USD 121.00

2 Weeks

MYL12B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MYL12B (NM_001144944) Human Over-expression Lysate
LC428596

USD 121.00

2 Weeks

MYL12B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MYL12B (NM_001144945) Human Over-expression Lysate
LC428597

USD 121.00

2 Weeks

MYL12B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MYL12B (NM_001144946) Human Over-expression Lysate
LC428598

USD 121.00

2 Weeks

MYL12B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MYL12B (NM_001144944) Human Over-expression Lysate
LY428596

USD 396.00

5 Days

Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MYL12B (NM_001144945) Human Over-expression Lysate
LY428597

USD 396.00

5 Days

Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MYL12B (NM_001144946) Human Over-expression Lysate
LY428598

USD 396.00

5 Days

Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB