IFNA4 (Myc-DDK-tagged)-Human interferon, alpha 4 (IFNA4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IFNA4 (Myc-DDK-tagged)-Human interferon, alpha 4 (IFNA4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, IFNA4 (Myc-DDK tagged) - Human interferon, alpha 4 (IFNA4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, IFNA4 (mGFP-tagged) - Human interferon, alpha 4 (IFNA4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
IFNA4 (GFP-tagged) - Human interferon, alpha 4 (IFNA4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interferon, alpha 4 (IFNA4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IFNA4 (Myc-DDK tagged) - Human interferon, alpha 4 (IFNA4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interferon, alpha 4 (IFNA4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IFNA4 (mGFP-tagged) - Human interferon, alpha 4 (IFNA4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interferon, alpha 4 (IFNA4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
IFNA4 (untagged)-Human interferon, alpha 4 (IFNA4)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interferon, alpha 4 (IFNA4), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Purified recombinant protein of Human interferon, alpha 4 (IFNA4)
Tag | C-His |
Expression Host | HEK293 |
IFNA4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of interferon, alpha 4 (IFNA4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal IFNA4 Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4. |
Rabbit Polyclonal Anti-IFNA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
IFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_066546)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of IFNA4 (NM_021068) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human interferon, alpha 4 (IFNA4)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human interferon, alpha 4 (IFNA4)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human interferon, alpha 4 (IFNA4)
Tag | C-His |
Expression Host | HEK293 |
Transient overexpression of IFNA4 (NM_021068) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IFNA4 (NM_021068) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack