Germany
Japan
United Kingdom
China
EGLN3 (Myc-DDK-tagged)-Human egl nine homolog 3 (C. elegans) (EGLN3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human egl nine homolog 3 (C. elegans) (EGLN3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, EGLN3 (Myc-DDK tagged) - Human egl nine homolog 3 (C. elegans) (EGLN3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, EGLN3 (mGFP-tagged) - Human egl nine homolog 3 (C. elegans) (EGLN3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
EGLN3 (GFP-tagged) - Human egl nine homolog 3 (C. elegans) (EGLN3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, EGLN3 (Myc-DDK tagged) - Human egl nine homolog 3 (C. elegans) (EGLN3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human egl nine homolog 3 (C. elegans) (EGLN3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EGLN3 (mGFP-tagged) - Human egl nine homolog 3 (C. elegans) (EGLN3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of egl nine homolog 3 (C. elegans) (EGLN3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human egl nine homolog 3 (C. elegans) (EGLN3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human egl nine homolog 3 (C. elegans) (EGLN3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
EGLN3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human egl nine homolog 3 (C. elegans) (EGLN3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal HIF Prolyl Hydroxylase 3 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues between 50-100 of human Prolyl Hydroxylase Domain-Containing Protein 3 using the numbering given in entry NP_071356.1 (GeneID 112399). |
EGLN3 (untagged)-Human egl nine homolog 3 (C. elegans) (EGLN3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Polyclonal Antibody against EGLN3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RLGKYYVKERSK, from the internal region of the protein sequence according to NP_071356.1. |
Rabbit Polyclonal Anti-EGLN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3. Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT |
Mouse monoclonal Anti-PHD3 Clone EG188e/d5
| Reactivities | Human |
| Conjugation | Unconjugated |
EGLN3 / PHD3 (1-239, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
EGLN3 / PHD3 (1-239, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
EGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_071356)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-EGLN3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Transient overexpression of EGLN3 (NM_022073) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EGLN3 (NM_022073) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EGLN3 (NM_022073) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- EGLN3
Pathways
- Renal cell carcinoma