Products

cDNA Clones (18)
Proteins (10)
Antibodies (4)
Jump to Filters
View as table Download
UGT1A6 (NM_001072) Human Tagged ORF Clone
RC215957

USD 420.00

In Stock

UGT1A6 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
UGT1A6 (NM_205862) Human Recombinant Protein
TP305752

USD 823.00

In Stock

Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
UGT1A6 (NM_001072) Human Tagged ORF Clone Lentiviral Particle
RC215957L1V

USD 820.00

4 Weeks

Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
UGT1A6 (NM_001072) Human Tagged ORF Clone Lentiviral Particle
RC215957L2V

USD 820.00

6 Weeks

Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UGT1A6 (NM_205862) Human Tagged ORF Clone
RC205752

USD 98.00

USD 390.00

In Stock

UGT1A6 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT1A6 (NM_205862) Human Tagged ORF Clone
RG205752

USD 460.00

In Stock

UGT1A6 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT1A6 (NM_001072) Human Tagged ORF Clone
RG215957

USD 460.00

In Stock

UGT1A6 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT1A6 (NM_205862) Human Tagged ORF Clone
RC205752L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A6 (NM_205862) Human Tagged ORF Clone Lentiviral Particle
RC205752L3V

USD 820.00

6 Weeks

Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A6 (NM_205862) Human Tagged ORF Clone
RC205752L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A6 (NM_205862) Human Tagged ORF Clone Lentiviral Particle
RC205752L4V

USD 820.00

6 Weeks

Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A6 (NM_001072) Human Tagged ORF Clone
RC215957L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A6 (NM_001072) Human Tagged ORF Clone Lentiviral Particle
RC215957L3V

USD 820.00

6 Weeks

Lenti ORF particles, UGT1A6 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A6 (NM_001072) Human Tagged ORF Clone
RC215957L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A6 (NM_001072) Human Tagged ORF Clone Lentiviral Particle
RC215957L4V

USD 820.00

6 Weeks

Lenti ORF particles, UGT1A6 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A6 (NM_001072) Human Untagged Clone
SC119463

USD 310.00

In Stock

UGT1A6 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
UGT1A6 (NM_001072) Human Tagged ORF Clone
RC215957L1

USD 768.00

In Stock

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
UGT1A6 Rabbit Polyclonal Antibody
TA346069

USD 475.00

5 Days

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A6 antibody: synthetic peptide directed towards the C terminal of human UGT1A6. Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK
UGT1A6 (NM_001072) Human Tagged ORF Clone
RC215957L2

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UGT1A6 Rabbit Polyclonal Antibody
TA309014

USD 415.00

5 Days

Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224)
UGT1A6 (NM_205862) Human Untagged Clone
SC321712

USD 420.00

In Stock

UGT1A6 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
UGT1A6 (NM_001072) Human Over-expression Lysate
LC400423

USD 121.00

2 Weeks

UGT1A6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
UGT1A6 (NM_205862) Human Mass Spec Standard
PH305752

USD 2,055.00

3 Weeks

UGT1A6 MS Standard C13 and N15-labeled recombinant protein (NP_995584)

Tag C-Myc/DDK
Expression Host HEK293
UGT1A6 Rabbit Polyclonal Antibody
TA351893

USD 345.00

In Stock

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UGT1A6
UGT1A6 Mouse Monoclonal Antibody [Clone ID: 8C6]
TA355386

USD 300.00

5 Days

UGT1A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
UGT1A6 (NM_205862) ICC Control Block
TB405752

USD 1,040.00

4 Weeks

Transient overexpression of UGT1A6 (NM_205862) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT1A6 (NM_001072) ICC Control Block
TB415957

USD 1,070.00

4 Weeks

Transient overexpression of UGT1A6 (NM_001072) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT1A6 Cytosection
TS405752

USD 225.00

4 Weeks

Transient overexpression of UGT1A6 (NM_205862) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGT1A6 Cytosection
TS405752P5

USD 889.00

4 Weeks

Transient overexpression of UGT1A6 (NM_205862) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

UGT1A6 Cytosection
TS415957

USD 225.00

4 Weeks

Transient overexpression of UGT1A6 (NM_001072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGT1A6 Cytosection
TS415957P5

USD 889.00

4 Weeks

Transient overexpression of UGT1A6 (NM_001072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack