Products

cDNA Clones (19)
Proteins (13)
Antibodies (9)
Jump to Filters
View as table Download
67kDa Laminin Receptor (RPSA) (NM_002295) Human Tagged ORF Clone
RG209795

USD 460.00

In Stock

RPSA (GFP-tagged) - Human ribosomal protein SA (RPSA), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
67kDa Laminin Receptor (RPSA) (NM_002295) Human Tagged ORF Clone Lentiviral Particle
RC209795L3V

USD 820.00

5 Weeks

Lenti ORF particles, RPSA (Myc-DDK tagged) - Human ribosomal protein SA (RPSA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
67kDa Laminin Receptor (RPSA) (NM_002295) Human Tagged ORF Clone Lentiviral Particle
RC209795L4V

USD 820.00

5 Weeks

Lenti ORF particles, RPSA (mGFP-tagged) - Human ribosomal protein SA (RPSA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
67kDa Laminin Receptor (RPSA) (NM_001012321) Human Tagged ORF Clone Lentiviral Particle
RC220075L3V

USD 820.00

6 Weeks

Lenti ORF particles, RPSA (Myc-DDK tagged) - Human ribosomal protein SA (RPSA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
67kDa Laminin Receptor (RPSA) (NM_001012321) Human Tagged ORF Clone Lentiviral Particle
RC220075L4V

USD 820.00

6 Weeks

Lenti ORF particles, RPSA (mGFP-tagged) - Human ribosomal protein SA (RPSA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
67kDa Laminin Receptor (RPSA) Rabbit Polyclonal Antibody
TA349397

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-RPSA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPSA
67kDa Laminin Receptor (RPSA) (NM_002295) Human Over-expression Lysate
LY400830

USD 396.00

5 Days

Transient overexpression lysate of ribosomal protein SA (RPSA), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
67kDa Laminin Receptor (RPSA) (NM_002295) Human Tagged ORF Clone
RC209795L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein SA (RPSA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
67kDa Laminin Receptor (RPSA) (NM_002295) Human Untagged Clone
SC320110

USD 310.00

In Stock

RPSA (untagged)-Human ribosomal protein SA (RPSA), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
67kDa Laminin Receptor (RPSA) Rabbit Polyclonal Antibody
TA326691

USD 430.00

5 Days

Rabbit Polyclonal RPSA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RPSA antibody was raised against a 17 amino acid peptide near the carboxy terminus of human RPSA.
67kDa Laminin Receptor (RPSA) Rabbit Polyclonal Antibody
AP20782PU-N

USD 407.00

2 Weeks

67kDa Laminin Receptor (RPSA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
67kDa Laminin Receptor (RPSA) (NM_001012321) Human Over-expression Lysate
LC423324

USD 121.00

In Stock

RPSA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
67kDa Laminin Receptor (RPSA) (NM_001012321) Human Over-expression Lysate
LY423324

USD 396.00

In Stock

Transient overexpression lysate of ribosomal protein SA (RPSA), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
67kDa Laminin Receptor (RPSA) Rabbit Polyclonal Antibody
TA335056

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPSA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPSA antibody: synthetic peptide directed towards the middle region of human RPSA. Synthetic peptide located within the following region: TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY
67kDa Laminin Receptor Mouse Monoclonal Antibody [Clone ID: OTI1G3]
CF811423

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPSA mouse monoclonal antibody,clone OTI1G3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
67kDa Laminin Receptor (RPSA) (NM_002295) Human Mass Spec Standard
PH309795

USD 2,055.00

3 Weeks

RPSA MS Standard C13 and N15-labeled recombinant protein (NP_002286)

Tag C-Myc/DDK
Expression Host HEK293
67kDa Laminin Receptor (RPSA) (AK055991) Human Untagged Clone
SC311604

USD 960.00

3 Weeks

(untagged)-Human cDNA FLJ31429 fis, clone NT2NE2000536, moderately similar to 40S RIBOSOMAL PROTEIN SA

Vector pCMV6 series
Tag Tag Free
67kDa Laminin Receptor (RPSA) ICC Control Block
TB409795

USD 1,070.00

4 Weeks

Transient overexpression of RPSA (NM_002295) in HEK293T cells paraffin embedded controls for ICC/IHC staining

67kDa Laminin Receptor (RPSA) ICC Control Block
TB420075

USD 1,070.00

4 Weeks

Transient overexpression of RPSA (NM_001012321) in HEK293T cells paraffin embedded controls for ICC/IHC staining

67kDa Laminin Receptor (RPSA) Cytosection
TS409795

USD 225.00

4 Weeks

Transient overexpression of RPSA (NM_002295) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

67kDa Laminin Receptor (RPSA) Cytosection
TS409795P5

USD 889.00

4 Weeks

Transient overexpression of RPSA (NM_002295) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

67kDa Laminin Receptor (RPSA) Cytosection
TS420075

USD 225.00

4 Weeks

Transient overexpression of RPSA (NM_001012321) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

67kDa Laminin Receptor (RPSA) ICC Control Sections
TS420075P5

USD 889.00

4 Weeks

Transient overexpression of RPSA (NM_001012321) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack