Products

View as table Download

MAT1A (Myc-DDK-tagged)-Human methionine adenosyltransferase I, alpha (MAT1A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human methionine adenosyltransferase I, alpha (MAT1A)

Tag C-Myc/DDK
Expression Host HEK293T

MAT1A (GFP-tagged) - Human methionine adenosyltransferase I, alpha (MAT1A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human methionine adenosyltransferase I, alpha (MAT1A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAT1A (Myc-DDK tagged) - Human methionine adenosyltransferase I, alpha (MAT1A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human methionine adenosyltransferase I, alpha (MAT1A), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAT1A (mGFP-tagged) - Human methionine adenosyltransferase I, alpha (MAT1A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MAT1A (untagged)-Human methionine adenosyltransferase I, alpha (MAT1A)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-MAT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Rabbit Polyclonal Anti-MAT1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the C terminal of human MAT1A. Synthetic peptide located within the following region: VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH

MAT1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human MAT1A

MAT1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

MAT1A (1-395, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

MAT1A (1-395, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

MAT1A MS Standard C13 and N15-labeled recombinant protein (NP_000420)

Tag C-Myc/DDK
Expression Host HEK293

Anti-MAT1A Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha

Anti-MAT1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha

USD 1,070.00

4 Weeks

Transient overexpression of MAT1A (NM_000429) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of MAT1A (NM_000429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of MAT1A (NM_000429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack