Germany
Japan
United Kingdom
China
USD 820.00
4 Weeks
Lenti ORF particles, SEPHS2 (Myc-DDK-tagged)-Human selenophosphate synthetase 2 (SEPHS2), (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadUSD 820.00
6 Weeks
Lenti ORF particles, SEPHS2 (mGFP-tagged) - Human selenophosphate synthetase 2 (SEPHS2), (Note: selenocystein protein, Internal stop codon present. See Summary below), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 823.00
4 Weeks
Purified recombinant protein of Homo sapiens selenophosphate synthetase 2 (SEPHS2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 420.00
In Stock
SEPHS2 (Myc-DDK-tagged)-Human selenophosphate synthetase 2 (SEPHS2), (Note, selenocysteine protein, internal stop codon, see reference data summary)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
In Stock
SEPHS2 (GFP-tagged) - Human selenophosphate synthetase 2 (SEPHS2), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-AC-GFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 620.00
3 Weeks
Lenti-ORF, SEPHS2 (Myc-DDK-tagged)-Human selenophosphate synthetase 2 (SEPHS2), (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, SEPHS2 (Myc-DDK-tagged)-Human selenophosphate synthetase 2 (SEPHS2), (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF, SEPHS2 (mGFP-tagged) - Human selenophosphate synthetase 2 (SEPHS2), (Note: selenocystein protein, Internal stop codon present. See Summary below)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, SEPHS2 (mGFP-tagged) - Human selenophosphate synthetase 2 (SEPHS2), (Note: selenocystein protein, Internal stop codon present. See Summary below), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-SEPHS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SEPHS2 antibody is: synthetic peptide directed towards the C-terminal region of Human SEPHS2. Synthetic peptide located within the following region: AATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGL |
SEPHS2 (untagged)-Human selenophosphate synthetase 2 (SEPHS2) (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-XL5 |
| Mammalian Cell Selection | None |
USD 620.00
In Stock
Lenti-ORF, SEPHS2 (Myc-DDK-tagged)-Human selenophosphate synthetase 2 (SEPHS2), (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
USD 620.00
3 Weeks
Lenti-ORF, SEPHS2 (mGFP-tagged) - Human selenophosphate synthetase 2 (SEPHS2), (Note: selenocystein protein, Internal stop codon present. See Summary below)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SEPHS2 (untagged)-Human selenophosphate synthetase 2 (SEPHS2) (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-AC |
| Mammalian Cell Selection | Neomycin |
USD 121.00
In Stock
SEPHS2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
5 Days
Transient overexpression lysate of selenophosphate synthetase 2 (SEPHS2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 2,055.00
3 Weeks
SEPHS2 MS Standard C13 and N15-labeled recombinant protein (NP_036380)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of SEPHS2 (NM_012248) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SEPHS2 (NM_012248) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SEPHS2 (NM_012248) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SEPHS2
Pathways
- Selenoamino acid metabolism